DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-D and Inafm1

DIOPT Version :9

Sequence 1:NP_001096958.1 Gene:inaF-D / 32126 FlyBaseID:FBgn0260812 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001129744.1 Gene:Inafm1 / 100192314 RGDID:2301983 Length:128 Species:Rattus norvegicus


Alignment Length:34 Identity:19/34 - (55%)
Similarity:25/34 - (73%) Gaps:1/34 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IRILTVAVYVLCVSLAAIMLSLYYIFIWDPTIRP 67
            :|:..|..|.|||||||::|::||..||.|| ||
  Rat    28 LRLAPVCAYFLCVSLAAVLLAVYYGLIWVPT-RP 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-DNP_001096958.1 InaF-motif 31..64 CDD:291678 15/29 (52%)
Inafm1NP_001129744.1 InaF-motif 25..58 CDD:291678 15/29 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005668
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34929
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.