DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-D and Inafm1

DIOPT Version :10

Sequence 1:NP_001096958.1 Gene:inaF-D / 32126 FlyBaseID:FBgn0260812 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001129744.1 Gene:Inafm1 / 100192314 RGDID:2301983 Length:128 Species:Rattus norvegicus


Alignment Length:34 Identity:19/34 - (55%)
Similarity:25/34 - (73%) Gaps:1/34 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IRILTVAVYVLCVSLAAIMLSLYYIFIWDPTIRP 67
            :|:..|..|.|||||||::|::||..||.|| ||
  Rat    28 LRLAPVCAYFLCVSLAAVLLAVYYGLIWVPT-RP 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-DNP_001096958.1 InaF-motif 31..64 CDD:464449 15/29 (52%)
Inafm1NP_001129744.1 InaF-motif 25..59 CDD:464449 17/31 (55%)

Return to query results.
Submit another query.