DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango10 and btbd3b

DIOPT Version :9

Sequence 1:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_003199784.1 Gene:btbd3b / 562593 ZFINID:ZDB-GENE-041210-282 Length:517 Species:Danio rerio


Alignment Length:278 Identity:64/278 - (23%)
Similarity:118/278 - (42%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ANANGTSESPAKGLNSSEDLDAKRRKCRETEEGQDEASTMIDANSVLNKIANLYAEQLMSDIVLL 148
            |:|....:...:.||::..:..    |    ..|...||:.:.|||      ::..:||:|:..:
Zfish    70 ASATTVQQYQQQNLNNNNTIQC----C----NWQGLYSTIRERNSV------MFNNELMADVHFV 120

  Fly   149 V----DGKEFPAHRVILCASSDVFQVMLMNPEWNECSKHVIELHEEACCSAVFPQFIKYLYVGQI 209
            |    ..:..|.|:.:|...|.||..|.    :.|.::...|:.........|...:||:|..:|
Zfish   121 VGQSGGTQRLPGHKYVLAVGSSVFHAMF----YGELAEDTDEIRIPDVEPPAFLAMLKYIYCDEI 181

  Fly   210 EVTLQTVMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYLVSWLQYTLSFTPTHNDLTETLK 274
            :::..||:..|..:.||.:..|...||:::...:: |..:..|:|  |..|...|   |||:...
Zfish   182 DLSADTVLATLYAAKKYIVPHLARACVNFLETSLS-AKNACILLS--QSCLFEEP---DLTQRCW 240

  Fly   275 RFLKWNLEMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDILQTWL---LHRREQMEATGSG 336
            ..:....|:..:|..|.::|...|..:|::..| ...|..:|:...:|.   ..|||.  .|...
Zfish   241 EVIDAQAELALKSDGFCDIDSQTLESILRRETL-NAKEIVVFEAALSWADAECQRREM--NTSID 302

  Fly   337 GFMELIEQTVSHIRFGMM 354
            ...:::.|::..||...|
Zfish   303 NKRKVLGQSIYLIRIPTM 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango10NP_001259461.1 BTB 135..239 CDD:279045 26/107 (24%)
BTB 144..242 CDD:197585 24/101 (24%)
BACK 258..359 CDD:197943 23/100 (23%)
btbd3bXP_003199784.1 BTB 108..211 CDD:279045 26/106 (25%)
BTB 116..215 CDD:197585 24/102 (24%)
BACK 221..327 CDD:197943 26/108 (24%)
PHR 372..515 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.