DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango10 and Btbd6

DIOPT Version :9

Sequence 1:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_964008.2 Gene:Btbd6 / 399566 MGIID:3026623 Length:539 Species:Mus musculus


Alignment Length:307 Identity:71/307 - (23%)
Similarity:124/307 - (40%) Gaps:57/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GGGGAGAGPGG---GPGGGAAAADLAGEAAGGAAGGDAAINNQANANGTSESPAKGL-------- 97
            |....||.|..   .|.....||:|...|:..||......|  :||.|.:||...||        
Mouse    32 GAKARGAAPTSAEPAPAVAKMAAELYPPASPSAATATDIAN--SNAAGAAESTKVGLCCPPCLAP 94

  Fly    98 -------------NSSEDLDAKRRKCRETEEGQDEASTMIDANSVLNKIANLYAEQLMSDIVLLV 149
                         |::.          |:...|....|:.:.|::      ::..:||:|:..:|
Mouse    95 APLPPLPAPPLPDNNNP----------ESPNWQSFHPTLRERNAL------MFNNELMADVHFIV 143

  Fly   150 D----GKEFPAHRVILCASSDVFQVMLMNPEWNECSKHVIELHEEACCSAVFPQFIKYLYVGQIE 210
            .    .:..|||:.:|...|.||..|.    :.:.::...|:|......|.|...:||:|..:|:
Mouse   144 GALGAARRVPAHKYVLAVGSSVFYAMF----YGDLAEVKSEIHIPDVEPAAFLVLLKYMYSDEID 204

  Fly   211 VTLQTVMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYLVSWLQYTLSFTPTHNDLTETLKR 275
            :...||:..|..:.||.:..|...||:::...: :|..:..|:|  |..|...|   :||:....
Mouse   205 LEADTVLATLYAAKKYIVPALAKACVNFLETSL-EAKNACVLLS--QSRLFEEP---ELTQRCWE 263

  Fly   276 FLKWNLEMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDILQTW 322
            .:....||...|..|.|:|...|.:::.: :.:.|.|..:|:.:..|
Mouse   264 VIDAQAEMALRSEGFCEIDRQTLEIIVTR-EALNTKEAVVFEAVLNW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango10NP_001259461.1 BTB 135..239 CDD:279045 28/107 (26%)
BTB 144..242 CDD:197585 26/101 (26%)
BACK 258..359 CDD:197943 15/65 (23%)
Btbd6NP_964008.2 BTB 130..233 CDD:279045 28/106 (26%)
BTB 138..237 CDD:197585 26/102 (25%)
BACK 243..349 CDD:197943 18/73 (25%)
PHR 394..537 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.