DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango10 and axed

DIOPT Version :9

Sequence 1:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster


Alignment Length:404 Identity:72/404 - (17%)
Similarity:131/404 - (32%) Gaps:168/404 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 GQDEASTMIDANSVLNKIANLYAEQLMSDIVLLV-----DGKEFPAHRVILCASSDVFQVMLMNP 175
            |.|......:..|||.:..         ::..|:     .|::...|..||....:.|::::...
  Fly   163 GDDRYMIRCERKSVLERSV---------ELAKLIHAGPNSGRKSDNHFQILNVDKNDFELIVRYM 218

  Fly   176 EWNECSKHVIELHEEACCSAVFPQFIKYLYVGQIEVTLQTVMPMLALSDKYNIRDLIDLCVDYM- 239
            |     ||.|...:.           |:|            :.:|.|||::|:.|||..|:..: 
  Fly   219 E-----KHFIPYRDH-----------KHL------------LKILELSDRFNVPDLIIYCIRELD 255

  Fly   240 ------------------------NKH-------------------VAKAA-------------- 247
                                    |:|                   .||||              
  Fly   256 LRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAAAKASQSTE 320

  Fly   248 --------------------TSGYLVSWLQYTLSFTPTHNDLTETLKRFLKWNLEMVAESRDFVE 292
                                |..|.|:.|..||.....|.:        |:.::..:::.| |.|
  Fly   321 NGAEGDGAQQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAE--------LQLSMPEISDLR-FEE 376

  Fly   293 MDPAILILLLQQNDLVVTSEYKLFDILQTWLLHR--REQMEATGSGGFMEL---------IEQTV 346
            ::     .|::::.|.:.||..||:.|.||.|..  |:.::||.......|         :..|.
  Fly   377 LE-----TLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRMTA 436

  Fly   347 SHI-----RFGMMTPRQLSHLLMDP--------LVEYHKEFLVE---------RIAIGMSYQSGH 389
            |..     |..::.|.::| |:.|.        |.:...|.|.:         |:.:.:|.:|..
  Fly   437 SEFRRCCERLELLPPTEIS-LITDALDGKKLKNLTDQQAELLEKFRQPRAEYARMPVHLSDRSSP 500

  Fly   390 EDRVREVRATESGK 403
            ::..:::|....|:
  Fly   501 KNYPKKMRLAHEGR 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango10NP_001259461.1 BTB 135..239 CDD:279045 21/108 (19%)
BTB 144..242 CDD:197585 22/127 (17%)
BACK 258..359 CDD:197943 25/116 (22%)
axedNP_001356975.1 BTB <192..258 CDD:197585 20/93 (22%)
BACK <354..423 CDD:355779 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.