DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango10 and gprs

DIOPT Version :9

Sequence 1:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_725599.2 Gene:gprs / 36862 FlyBaseID:FBgn0024232 Length:1302 Species:Drosophila melanogaster


Alignment Length:347 Identity:61/347 - (17%)
Similarity:123/347 - (35%) Gaps:84/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EGQDEASTMIDANSVLNKIANLYAEQLMSDIVLLVDGKEFP--AHRVILCASSDVFQVMLM---- 173
            :.:.:.||..:...:...:..|.:...:.|:..||.....|  |.:.:|.:.|.||..||.    
  Fly    12 DAEPDLSTFENKTGLAEDMKFLASMPELCDVTFLVGDTREPVCAVKAVLASRSRVFAKMLYAAPS 76

  Fly   174 ----------------------------------------------NPEWNECSKHVIELHEEAC 192
                                                          .|...:....:||..|   
  Fly    77 PQRKRETSTKENKLRLFLKRSSEPLLNLQNAAQQRTGYTQQLAPIPEPSGQQHQTLIIEEFE--- 138

  Fly   193 CSAVFPQFIKYLYVGQIEVTLQTVMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYLVS--- 254
             ..||.|.|:|::.|.:.:..:|::.::..:|.|.:.:|...|..::...:........|.|   
  Fly   139 -PDVFRQLIEYIHTGCVTLQPRTLLGVMNAADYYGLEELRRACAGFVQCCINVDTVCALLASAER 202

  Fly   255 WLQYTLSFTPTHNDLTETLKRFLKWNLEMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDIL 319
            ::||..:.|     |.:.:..|:..:...|.....|..:...::.|:|.:.:| ...|:..|   
  Fly   203 YIQYKCTKT-----LVQKVLEFVDEHGTEVLNLGSFTLLPQHVVRLILAREEL-RADEFTKF--- 258

  Fly   320 QTWLLHRREQMEATGSGGFMELIEQTVSHIRFGMMTPRQLSHLLMDPLVEYHKEFLVERIAI--G 382
            |..|:..::..:...:....|::.....:|:|..:.    :::||.   |.|...||....|  .
  Fly   259 QAALMWSKKYYDNNPNIDIKEILGTFCEYIQFHKIP----ANVLMR---EIHPLNLVPYAIIMNA 316

  Fly   383 MSYQSGHEDRVREVRATESGKL 404
            ::||:..|       :.:.|||
  Fly   317 LAYQADPE-------SIDPGKL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango10NP_001259461.1 BTB 135..239 CDD:279045 27/155 (17%)
BTB 144..242 CDD:197585 26/149 (17%)
BACK 258..359 CDD:197943 16/100 (16%)
gprsNP_725599.2 BTB 38..185 CDD:279045 26/150 (17%)
BTB 41..180 CDD:197585 25/142 (18%)
BACK 193..300 CDD:197943 20/119 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24410
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.