DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango10 and CG7102

DIOPT Version :9

Sequence 1:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001285729.1 Gene:CG7102 / 34079 FlyBaseID:FBgn0031961 Length:515 Species:Drosophila melanogaster


Alignment Length:365 Identity:66/365 - (18%)
Similarity:124/365 - (33%) Gaps:96/365 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 EDLDAKRRKCRETEEGQDEASTMIDANSVLNKIANLYAEQLMSDIVLLVDGKEF-PAHRVILC-- 162
            |||       :...|.||.|    |...:..:...:||.:||    |:...|.| .|.|..:|  
  Fly     8 EDL-------QRLSEDQDSA----DVVFICGRDERIYAHRLM----LMARCKSFKTAKRGEVCRI 57

  Fly   163 ------------ASSDVFQVMLMNPEWNECSKHVIELHEEACCSAVFPQFIKYLYVGQIEVTLQT 215
                        ::....::..:|||                   :|.|||.|:|..::.:....
  Fly    58 PGCTVSPAAPGASTPTTIRLPHVNPE-------------------LFRQFILYVYTAKLVLQDSQ 103

  Fly   216 VMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYLVSWLQYTLSFTPTHNDL-TETLKRFLKW 279
            |..|:.|:....:.:|...|.|    ||....:.....::|...:..   |... .:....|::.
  Fly   104 VFQMMILAQDIGVVELRTACED----HVISTLSVDNACTFLTAVMDI---HEKAGAKCAASFMER 161

  Fly   280 NLEMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDILQTW----------------LLHRRE 328
            .:..:.|:.:......|.|.|.......:::|:|...:..:.|                ..|..|
  Fly   162 CIIYIGENANECVKTNAFLTLTKDAIIKIISSDYFCLEEEEVWRCVLSWAKYQAGVTQPTAHWTE 226

  Fly   329 QMEATGSGGFMELIEQTVSHIRFGMMTPRQLSHLLMDPLVEYHKEFLVERIAIGMSYQSGHEDRV 393
            :..|.    ..:.:...:.|:|. ::...|:....::|......|..:||    ..|.:.|.:::
  Fly   227 EERAR----VCQHLSGVMGHVRL-LLIDSQVFAEEVEPTGAVPMELSLER----YRYAALHANKM 282

  Fly   394 REVRATESGKLQFTPRLYWNDTWSVDIDVHNFTAIEDYKN 433
            .:    ...:||  |||        .:.|:.|...:..||
  Fly   283 MD----NDKRLQ--PRL--------AVAVNMFPGSQILKN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango10NP_001259461.1 BTB 135..239 CDD:279045 25/118 (21%)
BTB 144..242 CDD:197585 21/112 (19%)
BACK 258..359 CDD:197943 14/117 (12%)
CG7102NP_001285729.1 BTB 10..128 CDD:279045 32/155 (21%)
BTB 21..131 CDD:197585 28/136 (21%)
BACK 143..255 CDD:197943 15/119 (13%)
TLDc 303..477 CDD:214733 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24410
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.