DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango10 and Btbd3

DIOPT Version :9

Sequence 1:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001101252.1 Gene:Btbd3 / 311462 RGDID:1311623 Length:528 Species:Rattus norvegicus


Alignment Length:292 Identity:64/292 - (21%)
Similarity:113/292 - (38%) Gaps:61/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AGEAAGGAAGGDAAINNQANANGTSESP------------------------AKGLNSSE---DL 103
            |..::||.:||         ::|:|:.|                        .|..|||.   .|
  Rat    33 ANSSSGGGSGG---------SSGSSKLPPVCYEIITLKTKKKKKMAADIFPRKKPANSSSTTVQL 88

  Fly   104 DAKRRKCRE----TEEGQDEASTMIDANSVLNKIANLYAEQLMSDIVLLV----DGKEFPAHRVI 160
            ..:...|..    ....|....|:.:.|:|      ::...||:|:..:|    ..:..|.|:.:
  Rat    89 QHQHNLCNNNLIPAPNWQGLYPTIRERNAV------MFNNDLMADVHFVVGPPGGTQRLPGHKYV 147

  Fly   161 LCASSDVFQVMLMNPEWNECSKHVIELHEEACCSAVFPQFIKYLYVGQIEVTLQTVMPMLALSDK 225
            |...|.||..|.    :.|.::...|:.......|.|...:||:|..:|::...||:..|..:.|
  Rat   148 LAVGSSVFHAMF----YGELAEDKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKK 208

  Fly   226 YNIRDLIDLCVDYMNKHVAKAATSGYLVSWLQYTLSFTPTHNDLTETLKRFLKWNLEMVAESRDF 290
            |.:..|...||:::...:: |..:..|:|  |..|...|   |||:.....:....|:..:|..|
  Rat   209 YIVPHLARACVNFLETSLS-AKNACVLLS--QSCLFEEP---DLTQRCWEVIDAQAELALKSEGF 267

  Fly   291 VEMDPAILILLLQQNDLVVTSEYKLFDILQTW 322
            .::|...|..:|::..| ...|..:|:....|
  Rat   268 CDIDFQTLESILRRETL-NAKEIVVFEAALNW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango10NP_001259461.1 BTB 135..239 CDD:279045 27/107 (25%)
BTB 144..242 CDD:197585 25/101 (25%)
BACK 258..359 CDD:197943 15/65 (23%)
Btbd3NP_001101252.1 BTB 119..222 CDD:279045 27/106 (25%)
BTB 127..226 CDD:197585 25/102 (25%)
BACK 232..338 CDD:197943 18/73 (25%)
PHR 383..526 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.