DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango10 and Btbd3

DIOPT Version :9

Sequence 1:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_663509.2 Gene:Btbd3 / 228662 MGIID:2385155 Length:530 Species:Mus musculus


Alignment Length:315 Identity:68/315 - (21%)
Similarity:118/315 - (37%) Gaps:63/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GADGAGGAGGGGGCGAGGGGAGAGPGGGP------------GGGAAAADLAGEAAGGAAGGDAAI 80
            |:..|..:||||    |||..|:|....|            .....|||:.              
Mouse    29 GSKKANSSGGGG----GGGSVGSGSSKLPPVCYEIITLKTKKKKKMAADIF-------------- 75

  Fly    81 NNQANANGTSESPAKGLNSSEDLDAKRRKCRE----TEEGQDEASTMIDANSVLNKIANLYAEQL 141
                    ..:.||...:::.....:...|..    ....|....|:.:.|:|      ::...|
Mouse    76 --------PRKKPANSSSTTVQQQHQHNLCNNNLIPAPNWQGLYPTIRERNAV------MFNNDL 126

  Fly   142 MSDIVLLV----DGKEFPAHRVILCASSDVFQVMLMNPEWNECSKHVIELHEEACCSAVFPQFIK 202
            |:|:..:|    ..:..|.|:.:|...|.||..|.    :.|.::...|:.......|.|...:|
Mouse   127 MADVHFVVGPPGGTQRLPGHKYVLAVGSSVFHAMF----YGELAEDKDEIRIPDVEPAAFLAMLK 187

  Fly   203 YLYVGQIEVTLQTVMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYLVSWLQYTLSFTPTHN 267
            |:|..:|::...||:..|..:.||.:..|...||:::...:: |..:..|:|  |..|...|   
Mouse   188 YIYCDEIDLAADTVLATLYAAKKYIVPHLARACVNFLETSLS-AKNACVLLS--QSCLFEEP--- 246

  Fly   268 DLTETLKRFLKWNLEMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDILQTW 322
            |||:.....:....|:..:|..|.::|...|..:|::..| ...|..:|:....|
Mouse   247 DLTQRCWEVIDAQAELALKSEGFCDIDFQTLESILRRETL-NAKEIVVFEAALNW 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango10NP_001259461.1 BTB 135..239 CDD:279045 27/107 (25%)
BTB 144..242 CDD:197585 25/101 (25%)
BACK 258..359 CDD:197943 15/65 (23%)
Btbd3NP_663509.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..48 10/22 (45%)
BTB 121..224 CDD:279045 27/106 (25%)
BTB 129..228 CDD:197585 25/102 (25%)
BACK 234..340 CDD:197943 18/73 (25%)
PHR 385..528 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.