DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango10 and Klhl25

DIOPT Version :9

Sequence 1:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001116252.1 Gene:Klhl25 / 207952 MGIID:2668031 Length:589 Species:Mus musculus


Alignment Length:335 Identity:67/335 - (20%)
Similarity:125/335 - (37%) Gaps:71/335 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 ETEEGQDEASTM--------IDANSVLNKIANLYAEQLMSDIVLLVDGKEFPAHRVILCASSDVF 168
            ||.:.:....:|        ...:.||..:..|....:.:|:.|....:.||.||.:|.|||..|
Mouse     7 ETRKSRSSTGSMNISVFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYF 71

  Fly   169 QVML---MNPEWNECSKHVIELHEEACCSAVFPQFIKYLYVGQIEVTLQTVMPMLALSDKYNIRD 230
            :.|.   :....::.......||.|     |....:.:.|..:|.:..:....:|...|.....|
Mouse    72 EAMFSHGLRESRDDTVNFQDNLHPE-----VLELLLDFAYSSRIVINEENAESLLEAGDMLQFHD 131

  Fly   231 LIDLCVDYMNKHVAKAATSGYLVSWLQYTLSFTPTHNDLTETLKRFLKWNLEMVAESRDFVEMDP 295
            :.|...:::.|:::.:...|.:|      ||.......|.|...|....:.|.|.:|.||..:..
Mouse   132 VRDAAAEFLEKNLSPSNCLGMMV------LSDAHQCRRLYEFSCRMSLVHFETVRQSEDFNSLSR 190

  Fly   296 AILILLLQQNDLVVTSEYKLFDILQTWLLHRREQMEA---------------------TGSGGFM 339
            ..|:.|:.:::|....|..:|:.:..|:.|..||.:|                     ..||..:
Mouse   191 DTLLDLISRDELETEDERVVFEAILQWVKHDLEQRKAHLPLLLRNVRLALLPSDCLKNAVSGEAL 255

  Fly   340 ELIEQ-------------TVSHIRFGMMT-----PRQLSHLLMDPLVEYHKEFLVERIAIGMSYQ 386
            .:.::             |...:..|::|     ||:..|.|   |:...:.|:.::|     ||
Mouse   256 LMADECTKLILDEAFRCKTKILLNDGVVTSPFARPRKAGHTL---LILGGQTFMCDKI-----YQ 312

  Fly   387 SGHEDRVREV 396
            ..|  :.:|:
Mouse   313 VDH--KAKEI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango10NP_001259461.1 BTB 135..239 CDD:279045 23/106 (22%)
BTB 144..242 CDD:197585 22/100 (22%)
BACK 258..359 CDD:197943 27/139 (19%)
Klhl25NP_001116252.1 BTB_POZ_KLHL25 24..151 CDD:349563 26/131 (20%)
PHA03098 39..566 CDD:222983 62/303 (20%)
Kelch 1 296..340 8/35 (23%)
KELCH repeat 330..374 CDD:276965
Kelch 2 341..388
KELCH repeat 378..431 CDD:276965
Kelch 3 389..444
KELCH repeat 434..480 CDD:276965
Kelch 4 446..492
KELCH repeat 482..524 CDD:276965
Kelch 5 493..538
KELCH repeat 528..565 CDD:276965
Kelch 6 539..585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.