DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and MPD1

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_014931.3 Gene:MPD1 / 854462 SGDID:S000005814 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:46/143 - (32%)
Similarity:73/143 - (51%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 KLTPQQLTGEDEFDQAI--AEGVAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCT 363
            :|||:      .||:||  ....:.::|||||||||:||..|:.:.|   .:....|::|.|:|.
Yeast    33 ELTPK------SFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAA---KRLDGVVQVAAVNCD 88

  Fly   364 APENKQVCIDQQVEGYPTLFLYK-----------NGQRQ-----NE-YEGSR--------SLPEL 403
            ..:||.:|....|.|:|||.:::           |.::.     || |.|:|        ||..:
Yeast    89 LNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRI 153

  Fly   404 QAYLKKFLGHDEL 416
            ::|:|||:..|.|
Yeast   154 RSYVKKFVRIDTL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 41/134 (31%)
PDI_a_ERp46 167..267 CDD:239303
PDI_a_ERp46 303..407 CDD:239303 39/130 (30%)
MPD1NP_014931.3 ER_PDI_fam 30..>275 CDD:273457 46/143 (32%)
PDI_a_MPD1_like 30..150 CDD:239300 38/125 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.