DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and MPD2

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_014553.1 Gene:MPD2 / 854065 SGDID:S000005448 Length:277 Species:Saccharomyces cerevisiae


Alignment Length:270 Identity:58/270 - (21%)
Similarity:98/270 - (36%) Gaps:89/270 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SILSVAVCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAIAGGN---VFVKFFAPWCG 66
            |:||..|.      :||....|:.....|..:|:        ||  |...|   ..:|::..||.
Yeast     9 SVLSTCVV------ILPALAYSEAVTMVKSIEQY--------FD--ICNRNDSYTMIKYYTSWCQ 57

  Fly    67 HCKRIQPLWEQLAEI----MNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRL----------- 116
            |||.:.|::|:|.|:    .|.|:..:...:|:| :..|......:.|:|.:.|           
Yeast    58 HCKTLAPVYEELGELYAKKANKDDTPINFLEVNC-EFFGPTLCTDLPGFPIIELVKPRTKPLVLP 121

  Fly   117 -------------------------FKLGEEESVKFKGTRDLPAITDFINKELSAPAE------- 149
                                     ::|.....|:|:|:|:|.::::||:...|...|       
Yeast   122 KLDWSSMKFHERLWQRIKTWFNNPKYQLDTSRVVRFEGSRNLKSLSNFIDTVRSKDTEERFIEHI 186

  Fly   150 ----ADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNHFVKFFAPWCSHCQR------LAPTW 204
                .:..|..|.|......||  :...||.:|.....|...|         :|      :....
Yeast   187 FDDSRNCNEELRSQQLLCKAGK--EYYSDTLSKLYGDVNGLEK---------ERRRLEALIKQNG 240

  Fly   205 EDLAKELIKE 214
            :||:|| :||
Yeast   241 DDLSKE-VKE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 28/144 (19%)
ER_PDI_fam 39..409 CDD:273457 49/236 (21%)
PDI_a_ERp46 167..267 CDD:239303 13/54 (24%)
PDI_a_ERp46 303..407 CDD:239303
MPD2NP_014553.1 Thioredoxin_like <48..170 CDD:412351 24/122 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45672
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.