DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and PDIL5-1

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001318951.1 Gene:PDIL5-1 / 837311 AraportID:AT1G07960 Length:146 Species:Arabidopsis thaliana


Alignment Length:127 Identity:43/127 - (33%)
Similarity:72/127 - (56%) Gaps:11/127 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KVVDLTEDTFAKHVSTGN--HFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRS 229
            :|:.||.:||:..:...:  .||||..|||.||::|...||||.|.:..:..:.:.::||...|:
plant    26 EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRA 90

  Fly   230 ICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGDEKVVIEE 291
            :|...|:..|||.:...:|:::.||.|.||:.:||.:|       :|:|  |...||..:|:
plant    91 VCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFV-------VEET--EKAAEKAQLED 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 43/127 (34%)
PDI_a_ERp46 167..267 CDD:239303 36/101 (36%)
PDI_a_ERp46 303..407 CDD:239303
PDIL5-1NP_001318951.1 Thioredoxin_like 27..128 CDD:412351 36/100 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45672
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.