DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and PDIL1-6

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_188232.2 Gene:PDIL1-6 / 820856 AraportID:AT3G16110 Length:534 Species:Arabidopsis thaliana


Alignment Length:508 Identity:111/508 - (21%)
Similarity:193/508 - (37%) Gaps:126/508 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSPLLPITRASQEE--------DTGKQDKQFTVELDPETFDTAIAGGN-VFVKFFAPWCGHCKRI 71
            |..||.:....|||        :|..:.::..|||:.:.....|.|.. |.|..:||||.....:
plant    46 LEQLLAVDEQLQEERPEQQSEAETVSKAQRIVVELNGDNTKRLIDGNEYVMVLGYAPWCARSAEL 110

  Fly    72 QPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAI 136
            .|.:.:.|..:......|::||:|..::..:.:..::.|:|||.||..|..:|  :.|......|
plant   111 MPRFAEAATDLKEIGSSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQS--YTGGFSSEEI 173

  Fly   137 TDFINKELSAPA-------EADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNH--FVKFFAP 192
            ..::.|:..|..       ||. |.:|:.....|.:          |.|...:..|  ||| .|.
plant   174 VIWVQKKTGASTIKLDTVDEAS-GFLKKHHTFILGL----------FEKSEDSSGHDEFVK-AAS 226

  Fly   193 WCSHCQRLAPTWEDLAKEL---IKEPTVTISKIDC-----TQFRSICQDFEV------KGYPTLL 243
            ..:..|.:..:..|:||.|   :|...|.:..:..     |.:...||..::      ..:|.:.
plant   227 LDNEIQFVETSSIDVAKLLFPNLKTNNVFVGLVKTEAEKYTSYDGPCQAEKIVEFLNSNKFPLVT 291

  Fly   244 WIEDGKKIEKYSGARDLSTL---KTYVEKMVGVPLEKTAGEAGDEKVVI------EEVA------ 293
            .:.:...:..||....|..:   ||...:.:..|||..|.:...:.::|      |.:|      
plant   292 KLTESNTVRVYSSPVKLQVMVFSKTDDFESLAQPLEDIARKFKSKLMLIYIDISNENLAMPFLTL 356

  Fly   294 -GEEDAAK--------KLTPQQLTGED-------EFDQAIAEGV--------------------- 321
             |.|||.|        .|..:.|...|       ||...:|.|.                     
plant   357 FGIEDAKKTVVAAFDNNLNSKYLLESDPSPSNIEEFCFGLAHGTVSAYYKSQPIPDNQNASVVAV 421

  Fly   322 ---------------AFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVC 371
                           ..::.:.|||.:|:.|....|:| ::..:...::..|::|.:|.|:.::.
plant   422 VGRTFDEVVLRSSENVLLEVHTPWCINCEALSKQVEKL-SQHFKGFENLVFARIDASANEHPKLT 485

  Fly   372 IDQQVEGYPTLFLYKNGQRQNEYEGS--RSLPELQAYLKKFL------GHDEL 416
            :|.    |||:.|||.|:::|..:.|  .|..::...:.|.|      |.|||
plant   486 VDD----YPTILLYKTGEKENPLKLSTKSSAKDMAVLINKELKWKDQSGKDEL 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 27/102 (26%)
ER_PDI_fam 39..409 CDD:273457 98/462 (21%)
PDI_a_ERp46 167..267 CDD:239303 23/118 (19%)
PDI_a_ERp46 303..407 CDD:239303 28/148 (19%)
PDIL1-6NP_188232.2 ER_PDI_fam 77..522 CDD:273457 98/463 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.