DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and UNE5

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_182269.1 Gene:UNE5 / 819360 AraportID:AT2G47470 Length:361 Species:Arabidopsis thaliana


Alignment Length:306 Identity:95/306 - (31%)
Similarity:153/306 - (50%) Gaps:41/306 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SILSVAVCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAIAGGNVFVKFFAPWCGHCK 69
            ::|::.:...:...::.:|..|.|::.|| ||                  ...|:|:||||||||
plant    11 ALLALLLVSAVADDVVVLTDDSFEKEVGK-DK------------------GALVEFYAPWCGHCK 56

  Fly    70 RIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLP 134
            ::.|.:|:|..... ....|:||||||.:.:.:|..:.|:||||::.|..|..|..|::|.|:..
plant    57 KLAPEYEKLGASFK-KAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAE 120

  Fly   135 AITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNH--FVKFFAPWCSHC 197
            |:.:::|||...       .||...|..    .||.||.|.|.:.|...|.  .|:|:||||.||
plant   121 ALAEYVNKEGGT-------NVKLAAVPQ----NVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHC 174

  Fly   198 QRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWI-EDGKKIEKYSGARDLS 261
            :.||||:|.:|....:|..|.|:.:|....:::.:.:.|.|:|||.:. :|.|....|.|.|||.
plant   175 KSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLD 239

  Fly   262 TLKTYVEKMVGVPLE---KTAGEAGD----EKVVIEEVAGEEDAAK 300
            ...:::.:..|...:   :...:||.    :.:|.|.||..||..|
plant   240 DFVSFINEKSGTSRDSKGQLTSKAGIVESLDALVKELVAASEDEKK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 33/101 (33%)
ER_PDI_fam 39..409 CDD:273457 87/272 (32%)
PDI_a_ERp46 167..267 CDD:239303 38/102 (37%)
PDI_a_ERp46 303..407 CDD:239303
UNE5NP_182269.1 PDI_a_ERp38 28..126 CDD:239296 40/117 (34%)
PDI_a_ERp38 142..245 CDD:239296 38/102 (37%)
ERp29c 266..357 CDD:238146 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.