DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and PDIL2-3

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_180851.1 Gene:PDIL2-3 / 817854 AraportID:AT2G32920 Length:440 Species:Arabidopsis thaliana


Alignment Length:395 Identity:108/395 - (27%)
Similarity:174/395 - (44%) Gaps:71/395 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VELDPETFDTAIAGGN--VFVKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGL 102
            |:|....|.:.:...|  |.|:||||||||||.:.|.||::|.|:   .....:|.:|...||..
plant    33 VQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL---KGVATVAAIDADAHQSA 94

  Fly   103 CATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKEL-----------SAPAEADLGEVK 156
            ...:.:.|:||:::|..| :..:.::|.||..:|.:|..|::           |.|......|.|
plant    95 AQDYGIKGFPTIKVFVPG-KAPIDYQGARDAKSIANFAYKQIKGLLSDRLEGKSKPTGGGSKEKK 158

  Fly   157 REQVENLNIGKVVDLTEDTFAKHVSTGNH--FVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTI 219
            .|...:      |:|....|...|...|.  .|:||||||.||::|||.|:..||.|  :..|.:
plant   159 SEPSAS------VELNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL--QGKVKL 215

  Fly   220 SKIDCTQFRSICQDFEVKGYPTLL-WIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAG 283
            ..::|...:||...|:|:|:||:| :..|......|.|||..|.::::..::|    |.:||.. 
plant   216 GHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELV----ESSAGPV- 275

  Fly   284 DEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAI-AEGVAFIKFYAPWC-----GHCQKLQPTWE 342
                   ||.            :|||.|..::.. :..:.||.|.....     |..:.|:....
plant   276 -------EVT------------ELTGPDVMEKKCGSAAICFISFLPDILDSKAEGRNKYLEMLLS 321

  Fly   343 QLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVE----GYPTLFLYKNGQRQNEYEGSRSLPEL 403
            .......|..|.:.:|.|       .|:.::::|.    |||.:...  ..::..|...:|..||
plant   322 VAEKFKKQPYSFMWVAAV-------TQMDLEKRVNVGGYGYPAMVAM--NVKKGVYAPLKSAFEL 377

  Fly   404 QAYLK 408
            |..|:
plant   378 QHLLE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 34/101 (34%)
ER_PDI_fam 39..409 CDD:273457 108/395 (27%)
PDI_a_ERp46 167..267 CDD:239303 37/102 (36%)
PDI_a_ERp46 303..407 CDD:239303 23/113 (20%)
PDIL2-3NP_180851.1 PDI_a_P5 31..132 CDD:239299 35/102 (34%)
PDI_a_P5 163..265 CDD:239299 37/109 (34%)
P5_C 274..403 CDD:239281 26/138 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.