DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and Pdia5

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_082571.1 Gene:Pdia5 / 72599 MGIID:1919849 Length:517 Species:Mus musculus


Alignment Length:416 Identity:104/416 - (25%)
Similarity:177/416 - (42%) Gaps:66/416 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSILSVAVCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPE-TFDTAIAGGN--VFVKFFAPWC 65
            |::...::...|..|..|   ...|||.|.:|   .|.:|.| .|...:....  :.:.|:||||
Mouse   122 RAVTLKSIVAFLKDPKGP---PLWEEDPGAKD---VVHIDSEKDFRRLLKREEKPLLMMFYAPWC 180

  Fly    66 GHCKRIQPLWEQLAEIMNVDNPKVIIAKVDC--TKHQGLCATHQVTGYPTLRLFKLGE------- 121
            ..||||.|.:::.|..:   ...:::|.::.  ::.:.:...:.|.||||:..|:.|.       
Mouse   181 SMCKRIMPHFQKAATQV---RGHIVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFLFPYEN 242

  Fly   122 -----EESVKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVS 181
                 |:.|::. ...||.     ..::.....||.|            |.|..||::.|.:.|.
Mouse   243 YGSTAEDIVEWL-KNPLPP-----QPQVPETPWADEG------------GSVYHLTDEDFDQFVK 289

  Fly   182 T-GNHFVKFFAPWCSHCQRLAPTWEDLAKEL--IKEPTVTISKIDCTQFRSICQDFEVKGYPTLL 243
            . .:..|.|.||||.||:::.|.:|..|:.|  ..|.:..::.:|.|...::...|.:..:|||.
Mouse   290 EHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATVNEALAGRFHISAFPTLK 354

  Fly   244 WIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGDEKVVIEEVAGEEDAAKKLTPQQLT 308
            :.::|::    .....|.|.|.::|.|           ...|.....|...||.....|   .|.
Mouse   355 YFKNGEQ----QAVPALRTKKKFIEWM-----------QNPEAPPPPEPTWEEQQTSVL---HLV 401

  Fly   309 GEDEFDQAIAEGVAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCID 373
            |::..|....:....:.||||||.||:|:.|.:...| :..:....:..|.|||...:|:.:|..
Mouse   402 GDNFRDTLKKKKHTLVMFYAPWCPHCKKVIPHFTATA-DAFKEDRKIACAAVDCVKDKNQDLCQQ 465

  Fly   374 QQVEGYPTLFLYKNGQRQNEYEGSRS 399
            :.|:.|||...|..|:...:||..|:
Mouse   466 EAVKAYPTFHYYHYGKLVEKYESDRT 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 27/118 (23%)
ER_PDI_fam 39..409 CDD:273457 95/381 (25%)
PDI_a_ERp46 167..267 CDD:239303 28/102 (27%)
PDI_a_ERp46 303..407 CDD:239303 29/97 (30%)
Pdia5NP_082571.1 PDI_b_PDIR_N 26..137 CDD:239365 2/14 (14%)
PTZ00102 122..517 CDD:240266 104/416 (25%)
PDI_a_PDIR 150..254 CDD:239295 26/109 (24%)
PDI_a_PDIR 275..377 CDD:239295 29/105 (28%)
PDI_a_PDIR 396..499 CDD:239295 30/100 (30%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 514..517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.