DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and Txndc16

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001297463.1 Gene:Txndc16 / 70561 MGIID:1917811 Length:820 Species:Mus musculus


Alignment Length:259 Identity:50/259 - (19%)
Similarity:105/259 - (40%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 EIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKEL 144
            |.:.:::.::||:.|....|                :.::.|:|....:|            .:|
Mouse   334 EFLVLNDVELIISHVKNNMH----------------IEEIQEDEGEDMEG------------PDL 370

  Fly   145 SAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNHFVKFFAPWCSHCQRLAPTWEDLAK 209
            :...:...|.|.|::.:.|.:...|:|||:||...|.|.:..|.|:|.|.:.......::.|:|.
Mouse   371 AVEDDEVAGTVYRDRKKPLPLELSVELTEETFNTTVMTSDSIVLFYATWHAVSMAFLQSYIDVAI 435

  Fly   210 ELIKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVE-KMVGV 273
            :|....|:.:::|:|..:..||....|..:|.:...::|:....|:|......|..::: ..:..
Mouse   436 KLKGRSTILLTRINCADWSDICTKQNVTAFPVVKLYKEGESPVSYAGMLATKDLLKFIQLNKISC 500

  Fly   274 PLEKTAGEAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGVAFIKFYAPWCGHCQKL 337
            |:               .:|..::|.|     .|.||...|...:..|:.:..::|.....::|
Mouse   501 PV---------------NIASIQEAEK-----YLRGELYKDLPSSASVSVLGLFSPAMASAKEL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 8/59 (14%)
ER_PDI_fam 39..409 CDD:273457 50/259 (19%)
PDI_a_ERp46 167..267 CDD:239303 26/99 (26%)
PDI_a_ERp46 303..407 CDD:239303 7/35 (20%)
Txndc16NP_001297463.1 ER_PDI_fam 65..493 CDD:273457 39/186 (21%)
PDI_a_family 395..493 CDD:239259 26/97 (27%)
Thioredoxin_6 534..722 CDD:372755 2/11 (18%)
Mediates endoplasmic reticulum retention. /evidence=ECO:0000250|UniProtKB:Q9P2K2 817..820
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.