DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and Erp27

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_081259.1 Gene:Erp27 / 69187 MGIID:1916437 Length:272 Species:Mus musculus


Alignment Length:319 Identity:56/319 - (17%)
Similarity:111/319 - (34%) Gaps:100/319 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTRS---ILS-VAVCGLLLSPLLPITRASQEEDT-GKQDKQFTVELD--PETFDTAIAGGNVFVK 59
            :|||   ||| |.|||     |:|...|..||.| |....|..:.|.  |.|.:...|.....:.
Mouse     3 ITRSRCLILSFVLVCG-----LVPEVTADVEEATDGLSTTQEPIWLTDVPATVELIAAAEVAVIG 62

  Fly    60 FFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEES 124
            ||          |.|...:..:......:........:.|..:...:.||. .::.||:|.:::.
Mouse    63 FF----------QDLEIPIVSVFRSMARQFQDVSFGISNHSEVLTHYNVTS-NSICLFRLVDDQQ 116

  Fly   125 VKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGN-HFVK 188
            :                            .:..|.:|||:..|:        ::.:...| |:|.
Mouse   117 L----------------------------HLNAEDIENLDAAKL--------SRFIHVNNLHWVT 145

  Fly   189 FFAPWC----------SH----CQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDFEVKGY 239
            .::|..          :|    .::.:|.:|:..:                ::|...:.|:  |.
Mouse   146 EYSPMIAAGLFNTMVQTHLLLMMKKTSPEYEESMR----------------RYREAAKLFQ--GQ 192

  Fly   240 PTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGD----EKVVIEEVAG 294
            ...:.::.||:    ...:.:|..|....::..:.:.::..:..|    .:|.:|:|.|
Mouse   193 ILFVLVDSGKR----ENGKVMSYFKLKESQLPALAIYESVDDKWDTLPIAEVTVEKVRG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 14/103 (14%)
ER_PDI_fam 39..409 CDD:273457 38/277 (14%)
PDI_a_ERp46 167..267 CDD:239303 15/114 (13%)
PDI_a_ERp46 303..407 CDD:239303
Erp27NP_081259.1 Thioredoxin_6 64..250 CDD:372755 33/253 (13%)
PDIA3-binding site. /evidence=ECO:0000250|UniProtKB:Q96DN0 230..233 0/2 (0%)
Prevents secretion from ER. /evidence=ECO:0000250|UniProtKB:Q96DN0 269..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.