DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and LOC685171

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001102929.1 Gene:LOC685171 / 685171 RGDID:1597712 Length:139 Species:Rattus norvegicus


Alignment Length:117 Identity:31/117 - (26%)
Similarity:55/117 - (47%) Gaps:11/117 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPA 135
            :.|.|::.|.::.    .|.:..||..:||.|...:.|.|:||:::|...:.:...::|.|...|
  Rat     2 LTPEWKKAATVLR----DVKVRAVDAGRHQSLGDQYGVQGFPTIKIFGASKTKPEYYQGGRTREA 62

  Fly   136 ITDFINKELSAPAEADLGE-----VKREQVENLNIGK--VVDLTEDTFAKHV 180
            ..|.....|....:..||.     ...:||:..:..|  :|:||:|||..:|
  Rat    63 TVDVALSALHQLLKDCLGRHSSVYCSGKQVKGDSSCKKDMVELTDDTFDYNV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 18/68 (26%)
ER_PDI_fam 39..409 CDD:273457 31/117 (26%)
PDI_a_ERp46 167..267 CDD:239303 8/16 (50%)
PDI_a_ERp46 303..407 CDD:239303
LOC685171NP_001102929.1 Thioredoxin_like <2..68 CDD:294274 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.