DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and TMX3

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_061895.3 Gene:TMX3 / 54495 HGNCID:24718 Length:454 Species:Homo sapiens


Alignment Length:275 Identity:71/275 - (25%)
Similarity:124/275 - (45%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KQFTVELDPETFDTAIAGGNVFVKFFAPWCGHCKRIQPLWEQLA-EIMNVDNPKVIIAKVDCTKH 99
            |.|..:|| |:|..........|.|:||||||||:::|:|.::. |:.::.:| |.:.|:|.|.:
Human    25 KGFVEDLD-ESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSP-VKVGKMDATSY 87

  Fly   100 QGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSA-----PAEADLGEV-KRE 158
            ..:.:...|.||||::|.|  .:.:..::|.|....|.:|.::...|     |::.....: ||.
Human    88 SSIASEFGVRGYPTIKLLK--GDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRH 150

  Fly   159 QVENLNIGKVVDLTEDTFAKHVSTGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKID 223
            :|..:.:|....|.|    |::...:..: .:..:.|..:.:.|.:..| ||:   |.|.:.| |
Human   151 RVFFVYVGGESPLKE----KYIDAASELI-VYTYFFSASEEVVPEYVTL-KEM---PAVLVFK-D 205

  Fly   224 CTQFRSICQDFEVKGYPTLLWIE----------DGKKIEKYSGARDLSTLKTYVEKMVGVPLEKT 278
            .|.|  :..::|.....:  ||.          ||..:.:......|..|....||       .|
Human   206 ETYF--VYDEYEDGDLSS--WINRERFQNYLAMDGFLLYELGDTGKLVALAVIDEK-------NT 259

  Fly   279 AGEAGDEKVVIEEVA 293
            :.|....|.:|:|||
Human   260 SVEHTRLKSIIQEVA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 33/102 (32%)
ER_PDI_fam 39..409 CDD:273457 69/272 (25%)
PDI_a_ERp46 167..267 CDD:239303 21/109 (19%)
PDI_a_ERp46 303..407 CDD:239303
TMX3NP_061895.3 PDI_a_TMX3 27..130 CDD:239298 34/106 (32%)
ER_PDI_fam 29..>346 CDD:273457 69/271 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..454
Di-lysine motif 451..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.