DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and pdia6

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001007974.1 Gene:pdia6 / 493341 XenbaseID:XB-GENE-974680 Length:441 Species:Xenopus tropicalis


Alignment Length:263 Identity:84/263 - (31%)
Similarity:135/263 - (51%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VVDLTEDTFAKHV--STGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSI 230
            |::||...|.|.|  |.....|:|:||||.|||||.|.|:..|..|  :..|.|..::..|.:|:
 Frog    27 VIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATAL--KGVVKIGAVNADQHQSL 89

  Fly   231 CQDFEVKGYPTL-LWIEDGKKIEKYSGARD--------LSTLKTYVEKMVGVPLEKTAGE----- 281
            ...:.|:|:||: ::..:..|.:.|.|.|.        ||:|:::|:..:|   .::.|.     
 Frog    90 GGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKDRLG---GRSGGSDSGRQ 151

  Fly   282 -----AGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAI--AEGVAFIKFYAPWCGHCQKLQP 339
                 .|.:|.||:                || :|.||:.:  ::.|.|::|||||||||:.|:|
 Frog   152 SYSSGGGSKKDVID----------------LT-DDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEP 199

  Fly   340 TWEQLATE-THQAQSSVKIAKVDCTAPENKQVCIDQQ-VEGYPTLFLYKNGQRQNEYEGSRSLPE 402
            .|...||| ..|....||:|.||.|.   .||...:. :.|:||:.:::.|:...:|:|.|:.|:
 Frog   200 EWAAAATEIKQQTNGKVKLAAVDATV---SQVLASRYGIRGFPTIKIFQKGEDPVDYDGGRTKPD 261

  Fly   403 LQA 405
            :.|
 Frog   262 IVA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 84/263 (32%)
PDI_a_ERp46 167..267 CDD:239303 37/109 (34%)
PDI_a_ERp46 303..407 CDD:239303 40/107 (37%)
pdia6NP_001007974.1 PDI_a_P5 26..128 CDD:239299 34/102 (33%)
PDI_a_P5 162..267 CDD:239299 42/123 (34%)
P5_C 276..405 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.