DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and p4hb

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_998529.3 Gene:p4hb / 406673 ZFINID:ZDB-GENE-080610-1 Length:509 Species:Danio rerio


Alignment Length:518 Identity:122/518 - (23%)
Similarity:195/518 - (37%) Gaps:175/518 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAI-AGGNVFVKFFAPWCGHCKRIQPL 74
            ||.|   ..:.....::|||        .:.|....|:.|: |..||.|:|:||||||||.:.|.
Zfish     7 VCAL---AAMSAAEIAEEED--------VLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPE 60

  Fly    75 WEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVK-FKGTRDLPAITD 138
            :.:.|.::..:...:.:||||.|:...|.....|.||||::.||.||:.:.| :...|....|..
Zfish    61 YSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVS 125

  Fly   139 FINKELSAPAEADLGEVKR-------------------------------EQVENLNIG------ 166
            ::.|. :.||...|.:|.:                               |.|:::..|      
Zfish   126 WLKKR-TGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDIPFGITSDDS 189

  Fly   167 ---------------KVVDLTEDTFAKHVSTGN--HFVK------------------FFAPWCSH 196
                           |..|...:||...||..:  :|:|                  |.....||
Zfish   190 VFAKFEVAKDSVVLFKKFDEGRNTFDGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSH 254

  Fly   197 CQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWI----EDGKKIEKYSGA 257
            .....|   ..||:.       ..|:|  ||:...:.|  ||....::|    :|.::|.::.| 
Zfish   255 ILMFVP---KAAKDF-------QDKMD--QFKKAAEGF--KGKILFIFIDSDVDDNQRILEFFG- 304

  Fly   258 RDLSTLKTYVEKMVGVPLEKTAGEAGDEKVVIEEVAGEEDAAK-KLTPQQLTGED--EFDQAIAE 319
                             |:|      :|..||..:..||:..| |....::|.|:  .|..:..|
Zfish   305 -----------------LKK------EECPVIRLITLEEEMTKYKPESSEITAENIISFCTSFVE 346

  Fly   320 GV-------------------------------------AFIKFYAPWCGHCQKLQPTWEQLATE 347
            |.                                     .|::|||||||||::|.|.|:||. |
Zfish   347 GTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLG-E 410

  Fly   348 THQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQN--EYEGSRSLPELQAYLK 408
            ..:..:::.:||:|.||.|.:.|    :|..:|||..:..|..:.  :|.|.|:|.....:|:
Zfish   411 KFKDNANIVVAKMDSTANEIEAV----KVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 36/103 (35%)
ER_PDI_fam 39..409 CDD:273457 116/490 (24%)
PDI_a_ERp46 167..267 CDD:239303 25/123 (20%)
PDI_a_ERp46 303..407 CDD:239303 37/144 (26%)
p4hbNP_998529.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.