DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and Txndc16

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_038949711.1 Gene:Txndc16 / 361025 RGDID:1306755 Length:854 Species:Rattus norvegicus


Alignment Length:342 Identity:70/342 - (20%)
Similarity:129/342 - (37%) Gaps:83/342 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 FKLGEEES-VKFKGTRDLPAI------------------TDFINKELSAPAEADLGEVKREQVEN 162
            |:..|::: |:|:...|:..|                  .|....:|:...:...|.|.|::...
  Rat   358 FRRAEKDAPVEFQVLNDVELIISHVKNNLYFEEIQEDEGEDMEGPDLAVEDDEVAGTVYRDRKRP 422

  Fly   163 LNIGKVVDLTEDTFAKHVSTGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQF 227
            |.:|.:|:|||:||...|...:..|.|:|.|.:.......::.|:|.:|....|:.:::|:|..:
  Rat   423 LPLGLLVELTEETFNTTVMASDTLVLFYATWHAVSMAFLQSYTDVAVKLKGRSTILLTRINCADW 487

  Fly   228 RSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGDEKVVIEEV 292
            ..:|....|..:|.:...::|:....|:|......|.|:::      |.|.:...        .:
  Rat   488 SDVCTKQNVTAFPMVKLYKEGESPVSYAGMLGSKDLLTFIQ------LNKISSPV--------NI 538

  Fly   293 AGEEDAAKKL--------------------TPQQLTGEDEFDQA-------IAEGV-----AFI- 324
            |..::|.|.|                    ||...:.::.|.:|       :..||     |:| 
  Rat   539 ASIQEAEKYLRGELYKDLFSFSSVSVLGLFTPAMTSAKECFQKAGKQLRGSVLTGVYSEDDAWIL 603

  Fly   325 -KFYA---PWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPT---- 381
             ..||   |.....:..:...|.:..:|...|..|:|.   ..||  .:...:..||..||    
  Rat   604 SNKYATTLPALLLARPKEGRIESVPLDTTPVQDMVQIL---ANAP--LEAFPEITVENLPTYLRF 663

  Fly   382 ----LFLYKNGQRQNEY 394
                |.|:.:|....:|
  Rat   664 QRPLLILFSDGSINPQY 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 7/41 (17%)
ER_PDI_fam 39..409 CDD:273457 70/342 (20%)
PDI_a_ERp46 167..267 CDD:239303 25/99 (25%)
PDI_a_ERp46 303..407 CDD:239303 26/117 (22%)
Txndc16XP_038949711.1 ER_PDI_fam <173..527 CDD:273457 38/168 (23%)
PDI_a_family 429..527 CDD:239259 25/97 (26%)
Thioredoxin_6 568..757 CDD:404691 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.