DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and pdia6

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_922915.2 Gene:pdia6 / 322160 ZFINID:ZDB-GENE-030131-879 Length:440 Species:Danio rerio


Alignment Length:297 Identity:86/297 - (28%)
Similarity:138/297 - (46%) Gaps:33/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSILSVAVCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAIAGGNV--FVKFFAPWCG 66
            |::|.|..|.|.:.....:..:|.:          .|||:|..|:..:...:.  .|:|:|||||
Zfish     2 RALLGVLACSLTVLSAYGLYTSSDD----------VVELNPSNFNREVIQSDSLWLVEFYAPWCG 56

  Fly    67 HCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTR 131
            |||.:.|.|::.|..:   ...|.:..||..:|..|...:.|.|:||:::|...:.:...::|.|
Zfish    57 HCKSLAPEWKKAATAL---KGIVKVGAVDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGR 118

  Fly   132 DLPAITDFINKELSAPAEADLG------EVKREQVENL-NIGKVVDLTEDTFAKHV--STGNHFV 187
            ...||.|.....|.:..:..||      :..|:..... |...||:||:|.|.:.|  |.....|
Zfish   119 TNQAIVDAALNALRSLVKDRLGGKTGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDVWLV 183

  Fly   188 KFFAPWCSHCQRLAPTWEDLAKELIKEPT---VTISKIDCTQFRSICQDFEVKGYPTLLWIEDGK 249
            :||||||.||:.|.|.|...|.| :||.|   |.::..|.|..:.:...|.::|:||:.....|:
Zfish   184 EFFAPWCGHCKNLEPEWTAAATE-VKEQTKGKVRLAAEDATVHQGLASRFGIRGFPTIKVFRKGE 247

  Fly   250 KIEKYSGARDLS-----TLKTYVEKMVGVPLEKTAGE 281
            :.|.|.|.|..|     .|:.|.:.:....|::...|
Zfish   248 EPEDYQGGRTRSDIVARALELYSDNIPAPELQEVLNE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 33/103 (32%)
ER_PDI_fam 39..409 CDD:273457 80/262 (31%)
PDI_a_ERp46 167..267 CDD:239303 39/109 (36%)
PDI_a_ERp46 303..407 CDD:239303
pdia6NP_922915.2 ER_PDI_fam 25..262 CDD:273457 76/250 (30%)
PDI_a_P5 26..128 CDD:239299 33/114 (29%)
PDI_a_P5 161..266 CDD:239299 38/105 (36%)
P5_C 275..404 CDD:239281 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.