DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and Pdilt

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_038963539.1 Gene:Pdilt / 293544 RGDID:1307822 Length:615 Species:Rattus norvegicus


Alignment Length:392 Identity:89/392 - (22%)
Similarity:151/392 - (38%) Gaps:96/392 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ITRASQEEDTGKQDKQFTVELDPETFDTAIAGGNV------FV-KFFAPW---CGHCKRIQPLWE 76
            :.:..:::.||     |.:|.:||..| .|...|:      |: |...|:   ..|.::|...::
  Rat   268 LNQVIKQQLTG-----FVIEFNPENKD-LIYEMNILNHMLLFISKNSEPYSTIIRHYRQISKEFQ 326

  Fly    77 Q--LAEIMNVDNPKVIIAKVDCTKHQGLCATHQVT--GYPTLRLFKLGEEESVKFKGTRD---LP 134
            .  |..::|.|.|          |::.:....|::  ..|::::..|..:  .::|...|   ..
  Rat   327 NKILFVLVNSDEP----------KNKRIFEYFQISRVNVPSVQILNLSSD--ARYKMPTDNITFE 379

  Fly   135 AITDFINKELSAPAEA-----------DLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNHFVK 188
            ::..|.|..||..|:.           |...||:...:|.|: .|.|..:|.          ||.
  Rat   380 SLKKFCNSFLSRTAKKHKSSEEIPKYWDQEPVKKLVGKNFNV-VVFDKEKDV----------FVM 433

  Fly   189 FFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDFEV---KGYPTL-LWIEDGK 249
            |:|||...|:.|.|..|:|..:.....||.|:|||.|     ..|.::   :.||.. |:..|.:
  Rat   434 FYAPWSEKCRVLLPLLEELGIKYQNHSTVIIAKIDIT-----ANDIQLANPEQYPFFRLFPTDSQ 493

  Fly   250 KIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGDEKVVIE--EVAGEE----------DAAKKL 302
            :...|.|...:.....::|..|.|.:|:     .||.:.||  |||.||          |...:.
  Rat   494 EAVMYKGEHTMKGFCDFLESHVKVRIEE-----DDELLYIEQNEVAEEEVLAEPEMQHIDKLPEK 553

  Fly   303 TPQQLTGEDEFDQAIAEGVAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAK-VDCTAPE 366
            .|.::....:.|:...|..|......|            |:|......|:...|:|: .:...||
  Rat   554 PPLKVEDTSKQDRPAKESPALGSISQP------------EELERRKETAEKEKKVAQPKEQPKPE 606

  Fly   367 NK 368
            .|
  Rat   607 RK 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 22/118 (19%)
ER_PDI_fam 39..409 CDD:273457 86/375 (23%)
PDI_a_ERp46 167..267 CDD:239303 28/103 (27%)
PDI_a_ERp46 303..407 CDD:239303 13/67 (19%)
PdiltXP_038963539.1 ER_PDI_fam 69..523 CDD:273457 66/293 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.