DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and SPAC959.05c

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_594172.4 Gene:SPAC959.05c / 2543474 PomBaseID:SPAC959.05c Length:632 Species:Schizosaccharomyces pombe


Alignment Length:376 Identity:68/376 - (18%)
Similarity:126/376 - (33%) Gaps:125/376 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLG-------EEESVKFKGTR 131
            :|.:    ::::.|.:..|||.|......||..::..:|.:.:.|.|       |:..:..|..|
pombe    63 IWNE----VSMEFPDIRRAKVFCDLDLEFCAQQEIYDHPKVVVLKNGMWMRHVLEKNQITTKSAR 123

  Fly   132 DLPAITDFINKELSAPAEADLGEVKREQVEN---------------LNIGKVVDLTEDTFAKHVS 181
            ..              .::.||....||.||               .:.....:|.||...||.|
pombe   124 QF--------------VKSHLGNCDLEQAENETDCFSDDGEYNSDSSSTDPAFELKEDQSWKHSS 174

  Fly   182 T--------------GNH-------FVKFFA-PWCSHCQRLAPTWEDLAKELIKEPTVTISKIDC 224
            .              ||.       ||.|.: ..|..|......|..:.:.  .:..:.:::::|
pombe   175 ILRPLETLNFKRFLFGNEIMSKTRAFVMFVSLKHCEDCFHWEAVWSSITRN--TDERLKMAQVNC 237

  Fly   225 TQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGDEKVVI 289
            .:.:.:|..|.:|.:||....:....|: |:|......|.:|..::           |..:.:.|
pombe   238 DEEKEMCNHFHIKKFPTFRVFQGFDSIQ-YNGPLKYQQLLSYSNQV-----------ASYQAIKI 290

  Fly   290 EEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGVAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSS 354
            ||  |:.::.:...|                |.|:..|               ..|| |.:..|.
pombe   291 EE--GDIESIENSHP----------------VFFLVLY---------------DFAT-TSEDFSI 321

  Fly   355 VKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQA 405
            ::..|:              |:.|...|::..:....|:| |::|.|.:.|
pombe   322 IERLKL--------------QLAGVAPLYICNSKALANKY-GAQSQPSIIA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 14/72 (19%)
ER_PDI_fam 39..409 CDD:273457 68/376 (18%)
PDI_a_ERp46 167..267 CDD:239303 24/121 (20%)
PDI_a_ERp46 303..407 CDD:239303 18/103 (17%)
SPAC959.05cNP_594172.4 PDI_a_family 183..278 CDD:239259 18/97 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.