DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and SPAC13F5.05

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_593653.1 Gene:SPAC13F5.05 / 2542841 PomBaseID:SPAC13F5.05 Length:363 Species:Schizosaccharomyces pombe


Alignment Length:95 Identity:37/95 - (38%)
Similarity:59/95 - (62%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 AEGVAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTL 382
            |:|.:.:.|||||||:|:||.||:::||:..|   |.:.:..|||.|.:|:.||...||:|:||:
pombe    47 AKGPSLVVFYAPWCGYCKKLVPTYQKLASNLH---SLLPVTAVDCDADQNRAVCSQYQVQGFPTI 108

  Fly   383 -FLYKNGQ----RQNEYEGSRSLPELQAYL 407
             .:|.:.:    ...:|.|.||...||.::
pombe   109 KLVYPSSKGSSLSSTDYNGDRSYKSLQKFV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 37/95 (39%)
PDI_a_ERp46 167..267 CDD:239303
PDI_a_ERp46 303..407 CDD:239303 37/93 (40%)
SPAC13F5.05NP_593653.1 PDI_a_MPD1_like 32..139 CDD:239300 37/95 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.