DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and Y73B6BL.12

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_500961.2 Gene:Y73B6BL.12 / 190648 WormBaseID:WBGene00022236 Length:136 Species:Caenorhabditis elegans


Alignment Length:75 Identity:32/75 - (42%)
Similarity:43/75 - (57%) Gaps:14/75 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VSTGNHF------------VKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQ 232
            ||.||.|            |.||||||.||.:.||.::.:||||..:  |..:||||.|:..:||
 Worm    21 VSLGNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDRIAKELAGK--VNFAKIDCDQWPGVCQ 83

  Fly   233 DFEVKGYPTL 242
            ..:|:.|||:
 Worm    84 GAQVRAYPTI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 32/75 (43%)
PDI_a_ERp46 167..267 CDD:239303 32/75 (43%)
PDI_a_ERp46 303..407 CDD:239303
Y73B6BL.12NP_500961.2 PDI_a_ERdj5_C 18..121 CDD:239302 32/75 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.