DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and pdi-6

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_509190.1 Gene:pdi-6 / 180974 WormBaseID:WBGene00015168 Length:440 Species:Caenorhabditis elegans


Alignment Length:326 Identity:89/326 - (27%)
Similarity:144/326 - (44%) Gaps:60/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTRSILSVAVCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAIAGGN--VFVKFFAP 63
            :|..|:...:|||:.          |:::|        .|||....|.:.:...:  ..|:|:||
 Worm     6 LLLASLAITSVCGMY----------SKKDD--------VVELTEANFQSKVINSDDIWIVEFYAP 52

  Fly    64 WCGHCKRIQPLWEQLAEIMNVDNPKVIIAK---VDCTKHQGLCATHQVTGYPTLRLFKLGEEESV 125
            ||||||.:.|.:::.|..:..      :||   ||.|:||.:...:.|.|:|||::|...:::..
 Worm    53 WCGHCKSLVPEYKKAASALKG------VAKVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPT 111

  Fly   126 KFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIG-------------KVVDLTEDTFA 177
            .:.|.|...||.|.:..|......|.||. |.....:...|             :||:||:..|.
 Worm   112 DYNGQRTAQAIADSVLAEAKKAVSARLGG-KSSGSSSSGSGSGSGKRGGGGSGNEVVELTDANFE 175

  Fly   178 KHV--STGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDFEVKGYP 240
            ..|  |.....|:||||||.||:.|.|.|:..|.||  :..|.:..:|.|....:...|.::|:|
 Worm   176 DLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAASEL--KGKVRLGALDATVHTVVANKFAIRGFP 238

  Fly   241 TLLWIEDGKKI---EKYSGARDLSTLKTYVEKMV--GVPLEKTAGEAGDEKVVIEEVAGEEDAAK 300
            |:.:...|..:   :.|.|.|..|.:..:.....  .:|..:.. |..:::||       |||.|
 Worm   239 TIKYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQENMPAPEVF-EGINQQVV-------EDACK 295

  Fly   301 K 301
            :
 Worm   296 E 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 34/106 (32%)
ER_PDI_fam 39..409 CDD:273457 82/288 (28%)
PDI_a_ERp46 167..267 CDD:239303 34/104 (33%)
PDI_a_ERp46 303..407 CDD:239303
pdi-6NP_509190.1 PDI_a_P5 25..127 CDD:239299 35/115 (30%)
PDI_a_P5 165..269 CDD:239299 34/105 (32%)
P5_C 278..407 CDD:239281 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.