DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and dnj-27

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001040704.1 Gene:dnj-27 / 173065 WormBaseID:WBGene00001045 Length:788 Species:Caenorhabditis elegans


Alignment Length:400 Identity:99/400 - (24%)
Similarity:175/400 - (43%) Gaps:79/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LDPETFDTAIAGGNVF-VKFFAPWCGHCKRIQPLWEQLAEIMNVDN--PKVIIAKVDCTKHQGLC 103
            |:.::::.||:||..: :.:|||||..|.::...:.:.....:.|:  ..|.|..:||.|::.||
 Worm   443 LNRDSYEYAISGGEFYIIDYFAPWCPPCMKLLGEYRRFHTATSEDSMLHTVAIGSLDCVKYKDLC 507

  Fly   104 ATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKV 168
            ....|..|||..:: ..:.::.|..|..::..|.:|::..|:    ..:.|:..||.|.|.:.: 
 Worm   508 QQAGVQSYPTSIVY-TPDGKTHKMVGYHNVDYILEFLDNSLN----PSVMEMSPEQFEELVMNR- 566

  Fly   169 VDLTEDTFAKHVSTGNHFVKFFAPWCSHCQRLAPTWEDLAKELIK-EPTVTISKIDCTQFRSICQ 232
              ..|:|:         .|.||||||..||:|||..:..|:::.. :....::.|||.::...|.
 Worm   567 --KDEETW---------LVDFFAPWCGPCQQLAPELQKAARQIAAFDENAHVASIDCQKYAQFCT 620

  Fly   233 DFEVKGYPTLLWIEDGKKIEKYSGA----------RDLSTLKTYVEKMVGVPLEKTAGEAGDEKV 287
            :.::..|||:. :...||.::...:          |:..:::.:|...  :|.|..:        
 Worm   621 NTQINSYPTVR-MYPAKKTKQPRRSPFYDYPNHMWRNSDSIQRWVYNF--LPTEVVS-------- 674

  Fly   288 VIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGVA--FIKFYAPWCGHCQKLQPTWEQLATETHQ 350
                                .|.| |...:.:...  .:.|:|||||||.:..|.::|:|.|   
 Worm   675 --------------------LGND-FHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDQIAKE--- 715

  Fly   351 AQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLY--KNG-QRQNEYEGSRSLPELQAYLK---- 408
            ....|..||:||  .:...||...||..|||:.||  |.| .||.:..........:.:::    
 Worm   716 LAGKVNFAKIDC--DQWPGVCQGAQVRAYPTIRLYTGKTGWSRQGDQGIGIGTQHKEQFIQIVRQ 778

  Fly   409 --KFLGHDEL 416
              |...||||
 Worm   779 QLKLDEHDEL 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 26/100 (26%)
ER_PDI_fam 39..409 CDD:273457 94/391 (24%)
PDI_a_ERp46 167..267 CDD:239303 25/110 (23%)
PDI_a_ERp46 303..407 CDD:239303 33/108 (31%)
dnj-27NP_001040704.1 DnaJ 18..>150 CDD:223560
DnaJ 20..82 CDD:278647
PDI_a_ERdj5_N 116..214 CDD:239301
Thioredoxin_like 222..>312 CDD:294274
ER_PDI_fam 438..750 CDD:273457 90/360 (25%)
PDI_a_ERdj5_C 438..543 CDD:239302 26/100 (26%)
PDI_a_ERdj5_C 549..664 CDD:239302 30/127 (24%)
PDI_a_ERdj5_C 670..773 CDD:239302 34/136 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.