DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and D2092.4

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_491903.2 Gene:D2092.4 / 172378 WormBaseID:WBGene00017065 Length:363 Species:Caenorhabditis elegans


Alignment Length:301 Identity:63/301 - (20%)
Similarity:105/301 - (34%) Gaps:81/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KQDKQFTVELDPETFDTAI--AGGNVFVKFF---APWCGHCKRIQPLWEQLAEIMNVDNPKVIIA 92
            |.|.....::|.:..|..:  |..|:.:..:   .| |..|.      |.|:|:..:|:      
 Worm    71 KDDDNSIDDVDEDRIDEILRDASKNLVIFLYDGKVP-CPTCT------EALSEVEEIDD------ 122

  Fly    93 KVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVK- 156
                        ..:.|||  :::.|..:....:..|....|::..:..|.   |...| |:.| 
 Worm   123 ------------DIEATGY--VQVVKTNDRSVARELGINVFPSLVYYRRKN---PILYD-GDFKD 169

  Fly   157 ----------REQVENLNIGKVVDLTEDTFAKHVSTGNH---------FVKFFAPWCSHCQRLAP 202
                      .|:|...      |||:|||...  |.:|         ||.|:.....:.....|
 Worm   170 SETLLRWLRAHEEVATW------DLTDDTFESR--TDSHSPDEGSIDWFVMFYDADEGNSNAFVP 226

  Fly   203 TWEDLAKELIKEPTVTISKIDCTQFRSICQDF--EVKGYPTLLWIEDGKKIEKYSGARDLSTLKT 265
            .||.:|.:|  ...|.:.||:.:....:.:.|  |.:..|..|....||.......|:|..:|..
 Worm   227 LWETVAHKL--RGLVNVGKIEISVNDDVTERFHIEERDCPVFLLFHRGKMYRYKESAKDARSLTN 289

  Fly   266 YVEKMVGVPLEKTAGEAG----DEKVVIEEVAGEEDAAKKL 302
            :.       |.|...:.|    :....||:|  .|.|.:|:
 Worm   290 FA-------LHKYKEQRGHRVPEPPTAIEQV--YEFAKEKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 17/106 (16%)
ER_PDI_fam 39..409 CDD:273457 61/295 (21%)
PDI_a_ERp46 167..267 CDD:239303 28/110 (25%)
PDI_a_ERp46 303..407 CDD:239303 63/301 (21%)
D2092.4NP_491903.2 Thioredoxin_like 92..177 CDD:381987 20/115 (17%)
PTZ00443 188..>316 CDD:185622 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.