DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prtp and PDIA6

DIOPT Version :9

Sequence 1:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001269633.1 Gene:PDIA6 / 10130 HGNCID:30168 Length:492 Species:Homo sapiens


Alignment Length:250 Identity:77/250 - (30%)
Similarity:132/250 - (52%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VVDLTEDTFAKHV--STGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSI 230
            |::||...|.:.|  |.....|:|:||||.|||||.|.|:..|..|  :..|.:..:|..:..|:
Human    79 VIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATAL--KDVVKVGAVDADKHHSL 141

  Fly   231 CQDFEVKGYPTL-LWIEDGKKIEKYSGARD--------LSTLKTYVEKMVGVPLEKTAGEAGDEK 286
            ...:.|:|:||: ::..:..:.|.|.|.|.        ||.|:..|:..:|   .::.|.:..::
Human   142 GGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLG---GRSGGYSSGKQ 203

  Fly   287 VVIEEVAGEEDAAKKLTPQQLTGEDEFDQAI--AEGVAFIKFYAPWCGHCQKLQPTWEQLATET- 348
                   |..|::.|....:|| :|.||:.:  :|.|..::|||||||||:.|:|.|...|:|. 
Human   204 -------GRSDSSSKKDVIELT-DDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVK 260

  Fly   349 HQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPEL 403
            .|.:..||:|.||.|.  |:.:.....:.|:||:.:::.|:...:|:|.|:..::
Human   261 EQTKGKVKLAAVDATV--NQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 77/249 (31%)
PDI_a_ERp46 167..267 CDD:239303 35/109 (32%)
PDI_a_ERp46 303..407 CDD:239303 36/103 (35%)
PDIA6NP_001269633.1 PDI_a_P5 78..180 CDD:239299 32/102 (31%)
PDI_a_P5 213..318 CDD:239299 36/103 (35%)
P5_C 327..456 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.