DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amun and AT3G12210

DIOPT Version :9

Sequence 1:NP_001188579.1 Gene:Amun / 32123 FlyBaseID:FBgn0030328 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_566413.1 Gene:AT3G12210 / 820401 AraportID:AT3G12210 Length:209 Species:Arabidopsis thaliana


Alignment Length:177 Identity:73/177 - (41%)
Similarity:100/177 - (56%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KPQELIRLDQWYQNELPKLIKARGKDAHMVYDELVQSMKWKQSRGKFYPQLSYLVKVNTPRAVIQ 104
            || ||:.|||:|:.:||.|:..|..:.::...||.|.||||.||||:.|:|...|.......|..
plant    29 KP-ELVSLDQFYRIKLPCLLHDRDPNPYLTTSELSQLMKWKLSRGKWRPRLLDFVSSLDDSVVKS 92

  Fly   105 ETKKAFRKLPNLEQAITALSNLKGVGTTMASALLAAAAPDSAPFMADECLMAIPEIEGIDYTTKE 169
            .::|||:.||::.:|:..|:.|||||...|||:|||.|||.||||:||. |.:......||:.|:
plant    93 ASEKAFKSLPDISKAVKELTVLKGVGAATASAVLAAYAPDIAPFMSDEA-MEVALGNSKDYSLKQ 156

  Fly   170 YLNFVNHIQATVERLNAEVGGDTPHWSPHRVELALWSHYVANDLSPE 216
            ||.|...:|...:.|..:...|    .|..:|.||||..|.....||
plant   157 YLLFATKLQDKAKELKLKGEWD----GPSDIERALWSCTVRAKSQPE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmunNP_001188579.1 PRK14157 216..>325 CDD:184543 1/1 (100%)
AT3G12210NP_566413.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100749
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007315
OrthoInspector 1 1.000 - - oto2813
orthoMCL 1 0.900 - - OOG6_105855
Panther 1 1.100 - - LDO PTHR21521
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6203
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.870

Return to query results.
Submit another query.