DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amun and zgc:112496

DIOPT Version :9

Sequence 1:NP_001188579.1 Gene:Amun / 32123 FlyBaseID:FBgn0030328 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001013483.1 Gene:zgc:112496 / 541336 ZFINID:ZDB-GENE-050320-25 Length:238 Species:Danio rerio


Alignment Length:276 Identity:89/276 - (32%)
Similarity:135/276 - (48%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VSFFETGSTKQFEYCYQLYPQVLKLKAEKRCKKPQELIRLDQWYQNELPKLIKARGKDAHMVYDE 72
            :|.|.......::..:..|..|::.|:..:.|...:|::||:|:|.:||..|.|| .:..:.:.|
Zfish     1 MSLFTCEDPAVWKAVHNKYWTVVEAKSAGKRKTSGKLLQLDKWFQEDLPAAITAR-PERFLTHAE 64

  Fly    73 LVQSMKWKQSRGKFYPQLSYLVKVNTPRAVIQETKKAFRKLPNLEQAITALSNLKGVGTTMASAL 137
            ||:.|:||.::|||.|:|..|:..|...||...:.|||..||:::.||..|..|||||:..|||:
Zfish    65 LVKIMEWKLTKGKFRPRLQQLIGSNNEEAVQSSSSKAFSLLPDVQAAIKELCKLKGVGSATASAV 129

  Fly   138 LAAAAPDSAPFMADECLMAIPEIEGIDYTTKEYLNFVNHIQATVERLN-AEVGGDTPHWSPHRVE 201
            |.|.|||...|||||.:.:|.|:..::||.|.|..::..:......|| .:...|   |:|||||
Zfish   130 LVAGAPDKVAFMADEAVESIAELRPVEYTDKHYALYLQKMLWKTSELNKVDAQQD---WTPHRVE 191

  Fly   202 LALWSHYVANDLSPEMLDDMPPPGSGASTGTGSLSTNGNSSKVLDGDDTNDGVGVDLDD-ESQGA 265
            ..||:..|||.:.|.:|.                                   ||.|.| .:|..
Zfish   192 QCLWTWTVANQIQPSLLQ-----------------------------------GVSLKDATNQKP 221

  Fly   266 GGRNTATESETENENT 281
            ..|.||.|..::.:.|
Zfish   222 EKRKTADEKPSKRKKT 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmunNP_001188579.1 PRK14157 216..>325 CDD:184543 11/67 (16%)
zgc:112496NP_001013483.1 ENDO3c <103..>151 CDD:304925 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28ITR
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100749
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007315
OrthoInspector 1 1.000 - - oto40738
orthoMCL 1 0.900 - - OOG6_105855
Panther 1 1.100 - - LDO PTHR21521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17362
SonicParanoid 1 1.000 - - X6203
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.