DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucT6 and AT5G28910

DIOPT Version :9

Sequence 1:NP_572740.1 Gene:FucT6 / 32122 FlyBaseID:FBgn0030327 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001031963.1 Gene:AT5G28910 / 833014 AraportID:AT5G28910 Length:535 Species:Arabidopsis thaliana


Alignment Length:401 Identity:79/401 - (19%)
Similarity:127/401 - (31%) Gaps:168/401 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 KEARDLSDLVQRRLHHLQNPSDCQN--ARKLVC--KLNKGCGYGCQLHHVVYCFIVAYATERTLI 291
            :|...|:..|||.:...|:|.||.|  .:.||.  :...|.|.|.|:..:.....:|....|.|:
plant   164 EENYPLTRRVQRDIWIHQHPLDCGNKSLKFLVADWETLPGFGIGAQIAGMTGLLAIAINENRVLV 228

  Fly   292 LKSRGWRYH-------KGGWEEVF-QPVSNSCHDAGTA----------------NTYN----WPG 328
            ........|       :|.|...| |..|..|.....|                ..|:    |.|
plant   229 ANYYNRADHDGCKGSFRGNWSCYFLQETSEECRKRAFAIVKKREAWESGIVTGKQNYSTKEIWAG 293

  Fly   329 -------------KPNTQVLVLPIIDSLMPRPPYLPLAVPEDLAPRLKRLHGDPIV--------W 372
                         ||.|::                               :|..|.        |
plant   294 AIPKQWGKPWSYMKPTTEI-------------------------------NGSLISNHRKMDRRW 327

  Fly   373 WVGQFLKYLLRPQPTTRDFLTSGMRNLG----------------------------------WE- 402
            |..|.::||:|.|..    .|.|:.|:.                                  |. 
plant   328 WRAQAVRYLMRYQTE----YTCGLMNIARNSAFGKEAAKIVLSAGDWRKKNKKMRTEIEEQVWSD 388

  Fly   403 ------RPIVGVHVRRTDKVGTEAACH----SVEEYMTYVEDYYRTL--EVNGSTVARRIFLASD 455
                  ||::.||||..||     ||.    ::|||| ::.|..|..  |:|      ||:|:::
plant   389 HKPWLPRPMLSVHVRMGDK-----ACEMRVAALEEYM-HLADRIRDRFPELN------RIWLSTE 441

  Fly   456 DAQVIEEARRKYPQYQI--------IGDPEVARMAS-----VSTRYTDTALNGIILDIHLLSMSD 507
            ..:|::.: :.|..::.        :|:..:|...:     :||.|.       :::..:.|.:|
plant   442 MKEVVDRS-KDYAHWRFYYTEVARQVGNKSMAEYEASLGREMSTNYP-------LVNFLMASEAD 498

  Fly   508 HLVCTFSSQVC 518
            ..|....|..|
plant   499 FFVGALGSTWC 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucT6NP_572740.1 Fut8_like 223..545 CDD:211386 79/401 (20%)
SH3_Fut8 552..606 CDD:212726
AT5G28910NP_001031963.1 O-FucT_like 169..518 CDD:302573 78/396 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13132
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.