DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucT6 and C10F3.7

DIOPT Version :9

Sequence 1:NP_572740.1 Gene:FucT6 / 32122 FlyBaseID:FBgn0030327 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_872204.2 Gene:C10F3.7 / 178984 WormBaseID:WBGene00015679 Length:188 Species:Caenorhabditis elegans


Alignment Length:214 Identity:42/214 - (19%)
Similarity:79/214 - (36%) Gaps:73/214 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 DPIVW--WVGQFLKYLLRPQPTTRDFLTSGMRNLGWERPIVGVHVRRTDKVGTEAACHSVEEYMT 430
            |..:|  |           :|.|.|.::||.::   :..::..:.|....: |:..|.  .|.|.
 Worm    25 DDFLWNRW-----------EPRTIDCVSSGKKD---DCVLLAPNSRIPFDI-TKFKCR--REPMP 72

  Fly   431 YVEDYYRTLEVNGSTVARRIFL-----ASDDAQVIEE---ARRKYPQYQIIGDPEVARMASVSTR 487
              :..:.||.||.:|   |:..     .:.|..|:::   ..:...:|...|            :
 Worm    73 --QTNWNTLAVNSTT---RLACPLNCPVNFDLSVLQKQPYVNKNCQKYYTYG------------K 120

  Fly   488 YTDTALNGIILDIHLLSMSDHLVCTFSSQVCRVAYEIMQTMYPDAAHRF-------KSLDDIYYY 545
            |.|.|.|    |.::. .::..|...|:. ||         :.|..|.:       |:|::: ..
 Worm   121 YWDVAAN----DWYIW-QTEPCVAAISTH-CR---------FNDVPHNYNPAKNTGKTLEEV-KL 169

  Fly   546 GG------QNAHNRRVVIA 558
            ||      |:...::||.|
 Worm   170 GGEILQTKQSEQRKKVVAA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucT6NP_572740.1 Fut8_like 223..545 CDD:211386 36/193 (19%)
SH3_Fut8 552..606 CDD:212726 3/7 (43%)
C10F3.7NP_872204.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.