DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2444 and CG34178

DIOPT Version :9

Sequence 1:NP_001285135.1 Gene:CG2444 / 32121 FlyBaseID:FBgn0030326 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001097082.1 Gene:CG34178 / 5740515 FlyBaseID:FBgn0085207 Length:112 Species:Drosophila melanogaster


Alignment Length:112 Identity:39/112 - (34%)
Similarity:50/112 - (44%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLLG----LVVILGGHVGQAAVAKVKLNN---SSHPGKCVLD---TNTILSPGETGLAPDLPCV 64
            |::.|    |||.       .|.|...|.|   |::|..||||   |..:|..|:......|||.
  Fly     8 FIIYGFLWSLVVF-------PAFANFSLYNYGDSAYPNCCVLDIDSTRILLKMGQKFRPKFLPCT 65

  Fly    65 RAECHADGLVTFKTCDAVAPPPGCKQRDFVNINREFPACCERKYNCD 111
            ...|..||.....|||...||..|..:|::|.:..:|.||.||..||
  Fly    66 TILCIGDGYGMLFTCDKKEPPEHCHFKDYLNGDANYPDCCYRKLECD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2444NP_001285135.1 SVWC 42..110 CDD:292070 26/70 (37%)
CG34178NP_001097082.1 SVWC 49..111 CDD:292070 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014352
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.