DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2444 and CG34177

DIOPT Version :9

Sequence 1:NP_001285135.1 Gene:CG2444 / 32121 FlyBaseID:FBgn0030326 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001097081.1 Gene:CG34177 / 5740338 FlyBaseID:FBgn0085206 Length:107 Species:Drosophila melanogaster


Alignment Length:75 Identity:23/75 - (30%)
Similarity:39/75 - (52%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SHPGKCVLDTNTILSPGETGLAPDLPCVRAECHADGLVTFKTCDAVAPPPGCKQRDFVNINREFP 101
            :|||||.::...:|:||.:...|...|.:..|..:|.|.:.:|......|.|:..|::|.:..:|
  Fly    33 NHPGKCTINPGLVLNPGVSIKDPTHECRKILCGLNGRVVYHSCGVSILSPPCRYGDYINPDLPYP 97

  Fly   102 ACCERKYNCD 111
            .||.|...|:
  Fly    98 DCCSRTLLCN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2444NP_001285135.1 SVWC 42..110 CDD:292070 18/67 (27%)
CG34177NP_001097081.1 SVWC 38..102 CDD:292070 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F87T
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014352
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.