DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2444 and CG14132

DIOPT Version :9

Sequence 1:NP_001285135.1 Gene:CG2444 / 32121 FlyBaseID:FBgn0030326 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001097586.1 Gene:CG14132 / 50290 FlyBaseID:FBgn0040817 Length:118 Species:Drosophila melanogaster


Alignment Length:105 Identity:29/105 - (27%)
Similarity:45/105 - (42%) Gaps:16/105 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGLVVILGGHVGQAAVAKVKLNNSSHPGKCVLDTNTILSPGETGLAPDLP------CVRAECHAD 71
            :.|:.|....|..|..::..:.:.:||||| .|..|     ...|.||..      |....|..:
  Fly    10 IALIAIFASVVDAAIYSQPAIFHPAHPGKC-FDKLT-----RKALLPDKEYKPKGICAAMTCSLE 68

  Fly    72 GL-VTFKTCDAVAPPPGCKQRDFVNINREFPACCERKYNC 110
            .| ::.:||..| ..|||::.. .:.|..||.||. ::.|
  Fly    69 ALEISIETCPYV-EAPGCEELP-SDPNWRFPKCCP-QFKC 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2444NP_001285135.1 SVWC 42..110 CDD:292070 20/74 (27%)
CG14132NP_001097586.1 SVWC 48..105 CDD:292070 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.