DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2444 and CG15202

DIOPT Version :9

Sequence 1:NP_001285135.1 Gene:CG2444 / 32121 FlyBaseID:FBgn0030326 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001245618.1 Gene:CG15202 / 32052 FlyBaseID:FBgn0030271 Length:115 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:36/97 - (37%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVILGGHVGQAAVAKVKLNNSSH---PGKCVLDTNTILSPGETGLAP---DLPCVRAECHADGLV 74
            :::|.|..|.|........|:.|   ||:|..:......|.:....|   :..|....|..|.::
  Fly     8 LLVLLGICGAARADLTYRGNAVHPDYPGQCYYEELNQAIPKKQSYKPINREGYCQSIYCRPDYVL 72

  Fly    75 TFKTCDAVAPPPGCKQRDFVNINREFPACCER 106
            ....|......|..|.|...::.|.||.||.:
  Fly    73 EISYCGRHNLVPTEKCRIASDMRRTFPECCPK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2444NP_001285135.1 SVWC 42..110 CDD:292070 15/68 (22%)
CG15202NP_001245618.1 SVWC 37..107 CDD:292070 15/68 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.