DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and PSKH2

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_016869418.1 Gene:PSKH2 / 85481 HGNCID:18997 Length:504 Species:Homo sapiens


Alignment Length:333 Identity:117/333 - (35%)
Similarity:172/333 - (51%) Gaps:39/333 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AAKG---FYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQ 76
            |.||   :..:|:.|.::|.|..|.|.|..:|.|.|.||.|::         ||......||...
Human   171 ANKGRNSYLRRYDIKALIGTGSFSRVVRVEQKTTKKPFAIKVM---------ETREREGREACVS 226

  Fly    77 EISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGV 141
            |:|:||:| .|.||:.|.::||::..|::|.||...|||||.|.:..:.:|:....|::.:.:|:
Human   227 ELSVLRRV-SHRYIVQLMEIFETEDQVYMVMELATGGELFDRLIAQGSFTERDAVRILQMVADGI 290

  Fly   142 EYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEK-----LTNLCGTPGYLAPET 198
            .|:||..|.||:|||||:|.   .|...:.|||||.|   ..|:|     :..|||||.|:|||.
Human   291 RYLHALQITHRNLKPENLLYYHPGEESKILITDFGLA---YSGKKSGDWTMKTLCGTPEYIAPEV 352

  Fly   199 LKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISED 263
            |.      ...|:..||:||.|||.:.||.|..||....|..:.|.|::|||::|...|..||..
Human   353 LL------RKPYTSAVDMWALGVITYALLSGFLPFDDESQTRLYRKILKGKYNYTGEPWPSISHL 411

  Fly   264 PKDLIRKCLVVDPSQRITVKEVLRHPFFNQMVLMGDRRHPAPPIAPAQTNSRHLLQ---PEASSY 325
            .||.|.|.|:::...|::..:.|.||:...|......::....|      ||:|:|   |.:.|.
Human   412 AKDFIDKLLILEAGHRMSAGQALDHPWVITMAAGSSMKNLQRAI------SRNLMQRASPHSQSP 470

  Fly   326 RFGQLNSS 333
            ...|.:.|
Human   471 GSAQSSKS 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 104/279 (37%)
S_TKc 23..291 CDD:214567 104/275 (38%)
PSKH2XP_016869418.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.