DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and MEK1

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_014996.3 Gene:MEK1 / 854533 SGDID:S000005878 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:362 Identity:96/362 - (26%)
Similarity:157/362 - (43%) Gaps:84/362 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DDLLPDKDA----AKGFYAKYEPKEILGRGI-SSTVRRCIEKETGKE-----------FAAKIID 55
            |||....|.    ..||..:.:..||..|.: :.|....:.....||           :|.|||.
Yeast   138 DDLQSSLDPKLLDQMGFLREVDQWEITNRIVGNGTFGHVLITHNSKERDEDVCYHPENYAVKIIK 202

  Fly    56 LGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVF-ESDAFVFLVFELCPKGELFDYL 119
            |       :.|.:.      :|..||.: :.||.||.:...| :.:..:::..:|.|.|:||.||
Yeast   203 L-------KPNKFD------KEARILLR-LDHPNIIKVYHTFCDRNNHLYIFQDLIPGGDLFSYL 253

  Fly   120 TS---VVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQL 178
            ..   :.::||.::..|:.||.:.:.|:|.:.|||||||.:||||   :....:.:.|||.||.|
Yeast   254 AKGDCLTSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCTPEPCTRIVLADFGIAKDL 318

  Fly   179 QEG-EKLTNLCGTPGYLAPE-----------------TLKCNMFEGSPGYSQEVDIWACGVIMFT 225
            ... |::..:.|||.|.|||                 ||:      ..||..:.|:|:.|||...
Yeast   319 NSNKERMHTVVGTPEYCAPEVGFRANRKAYQSFSRAATLE------QRGYDSKCDLWSLGVITHI 377

  Fly   226 LLVGCPPFW-HRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHP 289
            :|.|..||: ...:..:::|...||.:|...:|..:|::.|..::..|..|..:|:..|:.|:|.
Yeast   378 MLTGISPFYGDGSERSIIQNAKIGKLNFKLKQWDIVSDNAKSFVKDLLQTDVVKRLNSKQGLKHI 442

  Fly   290 FFNQMVLMGDRRHPAPPIAPAQTNSRHLLQPEASSYR 326
            :.                      ::||.|.|...|:
Yeast   443 WI----------------------AKHLSQLERLYYK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 86/309 (28%)
S_TKc 23..291 CDD:214567 85/305 (28%)
MEK1NP_014996.3 FHA 28..122 CDD:238017
STKc_CAMK 160..443 CDD:270687 85/302 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.