DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and DCLK3

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001381601.1 Gene:DCLK3 / 85443 HGNCID:19005 Length:817 Species:Homo sapiens


Alignment Length:274 Identity:103/274 - (37%)
Similarity:154/274 - (56%) Gaps:23/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGH 87
            ||...::|.|..:.|:.|..:||.:.:|.||||     :|.......|:::   ||.|: |.:.|
Human   525 YETGRVIGDGNFAVVKECRHRETRQAYAMKIID-----KSRLKGKEDMVDS---EILII-QSLSH 580

  Fly    88 PYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHR 152
            |.|:.|.:|:|:|..::|:.|....|:|||.:...|...|.....::..:.:.:.::|.||||||
Human   581 PNIVKLHEVYETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMDLCKALVHMHDKSIVHR 645

  Fly   153 DLKPENILLDENHN----VKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQE 213
            ||||||:|:..|.:    :|:.|||.||.:.  ..:..:||||.|:|||.|      ...||..|
Human   646 DLKPENLLVQRNEDKSTTLKLADFGLAKHVV--RPIFTVCGTPTYVAPEIL------SEKGYGLE 702

  Fly   214 VDIWACGVIMFTLLVGCPPFW--HRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDP 276
            ||:||.|||::.||.|.|||.  .|.|..:...|..|.:.|..|.|.:||:..|||:.:.|||||
Human   703 VDMWAAGVILYILLCGFPPFRSPERDQDELFNIIQLGHFEFLPPYWDNISDAAKDLVSRLLVVDP 767

  Fly   277 SQRITVKEVLRHPF 290
            .:|.|..:||:||:
Human   768 KKRYTAHQVLQHPW 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 103/274 (38%)
S_TKc 23..291 CDD:214567 103/274 (38%)
DCLK3NP_001381601.1 DCX_DCLK3 93..177 CDD:340528
STKc_DCKL3 524..781 CDD:271087 102/272 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.