DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and DUN1

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_010182.1 Gene:DUN1 / 851457 SGDID:S000002259 Length:513 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:104/308 - (33%)
Similarity:159/308 - (51%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DKDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQ 76
            :|.....|:.||...:.||.|..:.|:....|:||::.|.||.......:..:...:      |:
Yeast   189 NKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQF------RE 247

  Fly    77 EISILRQVMGHPYIIDLQDVF-----ESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQ 136
            |.:||.:|. ||.|::|.|.|     :|....:||.|....||||:.:.....|.:.:::.:.:|
Yeast   248 ETNILMRVQ-HPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQ 311

  Fly   137 IFEGVEYIHAKSIVHRDLKPENILL----------------DENH---NVKITDFGFAKQLQEGE 182
            :..|::|:|.::|:|||:|||||||                ||:.   .|||.|||.||...|.:
Yeast   312 LLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQ 376

  Fly   183 KLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLR-NIM 246
            ....|||||.|:|||.|.      ..||:.:||:|:.|||::..|.|.|||..:.....|: .|:
Yeast   377 FTNTLCGTPSYVAPEVLT------KKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQIL 435

  Fly   247 EGKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFNQM 294
            :.||:|.||.|..|.:....||...||::|.:|..:.|.|.||:||.:
Yeast   436 QAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWFNDI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 101/296 (34%)
S_TKc 23..291 CDD:214567 99/292 (34%)
DUN1NP_010182.1 FHA 36..136 CDD:238017
STKc_CAMK 199..479 CDD:270687 99/292 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.