DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and Dcx

DIOPT Version :10

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_006257444.1 Gene:Dcx / 84394 RGDID:620670 Length:366 Species:Rattus norvegicus


Alignment Length:228 Identity:38/228 - (16%)
Similarity:76/228 - (33%) Gaps:81/228 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFL 105
            :..:..:.|.|.:.||..:.......|        |.:..:..:.|...|..:.::.|.:::|  
  Rat    72 VSSDRFRSFDALLADLTRSLSDNINLP--------QGVRYIYTIDGSRKIGSMDELEEGESYV-- 126

  Fly   106 VFELCPKGELF-----------DYLTSVVTLSEKKTRTIM-----RQIFEGVEYIHAK--SIVHR 152
                |.....|           ::..:|.|.:..|....:     .|..|..:::..|  :|:..
  Rat   127 ----CSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRS 187

  Fly   153 DLKP----------------ENILLDENHNVKITDFGFAKQLQ--EGEKLTNL------------ 187
            .:||                |.:|.|....:|: :.|..|:|.  :|:::|.|            
  Rat   188 GVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKL-ETGVVKKLYTLDGKQVTCLHDFFGDDDVFIA 251

  Fly   188 CGTPGYLAPETLK------------CNMFEGSP 208
            ||      ||..:            |.:.:|:|
  Rat   252 CG------PEKFRYAQDDFSLDENECRVMKGNP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 38/228 (17%)
DcxXP_006257444.1 DCX1_DCX 51..139 CDD:340529 12/80 (15%)
DCX2 176..259 CDD:340589 18/89 (20%)
KLF8_12_N <284..>343 CDD:424081
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.