Sequence 1: | NP_511129.3 | Gene: | PhKgamma / 32120 | FlyBaseID: | FBgn0011754 | Length: | 560 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006257444.1 | Gene: | Dcx / 84394 | RGDID: | 620670 | Length: | 366 | Species: | Rattus norvegicus |
Alignment Length: | 228 | Identity: | 38/228 - (16%) |
---|---|---|---|
Similarity: | 76/228 - (33%) | Gaps: | 81/228 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 IEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFL 105
Fly 106 VFELCPKGELF-----------DYLTSVVTLSEKKTRTIM-----RQIFEGVEYIHAK--SIVHR 152
Fly 153 DLKP----------------ENILLDENHNVKITDFGFAKQLQ--EGEKLTNL------------ 187
Fly 188 CGTPGYLAPETLK------------CNMFEGSP 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PhKgamma | NP_511129.3 | STKc_PhKG | 19..291 | CDD:270995 | 38/228 (17%) |
S_TKc | 23..291 | CDD:214567 | 38/228 (17%) | ||
Dcx | XP_006257444.1 | DCX1_DCX | 51..139 | CDD:340529 | 12/80 (15%) |
DCX2 | 176..259 | CDD:340589 | 18/89 (20%) | ||
KLF8_12_N | <284..>343 | CDD:424081 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D330091at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |