DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and Dcx

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_006257444.1 Gene:Dcx / 84394 RGDID:620670 Length:366 Species:Rattus norvegicus


Alignment Length:228 Identity:38/228 - (16%)
Similarity:76/228 - (33%) Gaps:81/228 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFL 105
            :..:..:.|.|.:.||..:.......|        |.:..:..:.|...|..:.::.|.:::|  
  Rat    72 VSSDRFRSFDALLADLTRSLSDNINLP--------QGVRYIYTIDGSRKIGSMDELEEGESYV-- 126

  Fly   106 VFELCPKGELF-----------DYLTSVVTLSEKKTRTIM-----RQIFEGVEYIHAK--SIVHR 152
                |.....|           ::..:|.|.:..|....:     .|..|..:::..|  :|:..
  Rat   127 ----CSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRS 187

  Fly   153 DLKP----------------ENILLDENHNVKITDFGFAKQLQ--EGEKLTNL------------ 187
            .:||                |.:|.|....:|: :.|..|:|.  :|:::|.|            
  Rat   188 GVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKL-ETGVVKKLYTLDGKQVTCLHDFFGDDDVFIA 251

  Fly   188 CGTPGYLAPETLK------------CNMFEGSP 208
            ||      ||..:            |.:.:|:|
  Rat   252 CG------PEKFRYAQDDFSLDENECRVMKGNP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 38/228 (17%)
S_TKc 23..291 CDD:214567 38/228 (17%)
DcxXP_006257444.1 DCX1_DCX 51..139 CDD:340529 12/80 (15%)
DCX2 176..259 CDD:340589 18/89 (20%)
KLF8_12_N <284..>343 CDD:424081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.