DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK29

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_974150.2 Gene:CPK29 / 843936 AraportID:AT1G76040 Length:561 Species:Arabidopsis thaliana


Alignment Length:293 Identity:109/293 - (37%)
Similarity:156/293 - (53%) Gaps:22/293 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVM 85
            |.|:..:.||||......:|.:|..|:|:|.|.|.........:      :|..|:|:.||:.:.
plant   110 ALYDLHKELGRGQFGITYKCTDKSNGREYACKSISKRKLIRRKD------IEDVRREVMILQHLT 168

  Fly    86 GHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIV 150
            |.|.|::.:..:|....:.||.|||..|||||.:....:.|||:...|.|||...|...|...:|
plant   169 GQPNIVEFRGAYEDKDNLHLVMELCSGGELFDRIIKKGSYSEKEAANIFRQIVNVVHVCHFMGVV 233

  Fly   151 HRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQ 212
            ||||||||.||   :|:..:|.||||.:..::||:...::.|:..|:|||.|..|       |.:
plant   234 HRDLKPENFLLVSNEEDSPIKATDFGLSVFIEEGKVYRDIVGSAYYVAPEVLHRN-------YGK 291

  Fly   213 EVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPS 277
            |:|:|:.||:::.||.|.||||...:..:...|:|||....:..|..|||..||||||.|:.||.
plant   292 EIDVWSAGVMLYILLSGVPPFWGETEKTIFEAILEGKLDLETSPWPTISESAKDLIRKMLIRDPK 356

  Fly   278 QRITVKEVLRHPFFNQMVLMGDRRHPAPPIAPA 310
            :|||..|.|.||:      |.|.:....||..|
plant   357 KRITAAEALEHPW------MTDTKISDKPINSA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 104/272 (38%)
S_TKc 23..291 CDD:214567 103/270 (38%)
CPK29NP_974150.2 S_TKc 112..370 CDD:214567 103/276 (37%)
STKc_CAMK 112..369 CDD:270687 102/269 (38%)
PTZ00184 405..548 CDD:185504
EFh 417..476 CDD:238008
EFh 489..549 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.