DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK19

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_176386.2 Gene:CPK19 / 842490 AraportID:AT1G61950 Length:551 Species:Arabidopsis thaliana


Alignment Length:279 Identity:106/279 - (37%)
Similarity:146/279 - (52%) Gaps:23/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KYEPKEILGRGISSTVRRCIEKETGKEFAAKII---DLGATTESGETNPYHMLEATRQEISILRQ 83
            ||.....||||.......|.|..:||.||.|.|   .|..|.:.         |..|:||.|:..
plant    97 KYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTKDR---------EDVRREIQIMHY 152

  Fly    84 VMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKS 148
            :.|.|.|::::..:|....|.||.|||..|||||.:|.....|||....|:|.:.:.|:..|...
plant   153 LSGQPNIVEIKGAYEDRQSVHLVMELCEGGELFDKITKRGHYSEKAAAEIIRSVVKVVQICHFMG 217

  Fly   149 IVHRDLKPENILL---DE-NHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPG 209
            ::||||||||.||   || :..:|.||||.:..::||:...::.|:..|:|||.||.|       
plant   218 VIHRDLKPENFLLSSKDEASSMLKATDFGVSVFIEEGKVYEDIVGSAYYVAPEVLKRN------- 275

  Fly   210 YSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVV 274
            |.:.:|||:.|||::.||.|.||||......:...|:.|:..|.|..|..|||..|||:|..|..
plant   276 YGKAIDIWSAGVILYILLCGNPPFWAETDKGIFEEILRGEIDFESEPWPSISESAKDLVRNMLKY 340

  Fly   275 DPSQRITVKEVLRHPFFNQ 293
            ||.:|.|..:||.||:..:
plant   341 DPKKRFTAAQVLEHPWIRE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 106/275 (39%)
S_TKc 23..291 CDD:214567 105/274 (38%)
CPK19NP_176386.2 STKc_CAMK 97..356 CDD:270687 105/274 (38%)
Pkinase 98..357 CDD:278497 105/274 (38%)
PTZ00184 393..538 CDD:185504
EFh 405..464 CDD:238008
EFh 477..537 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.