DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CPK33

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001320603.1 Gene:CPK33 / 841492 AraportID:AT1G50700 Length:547 Species:Arabidopsis thaliana


Alignment Length:286 Identity:111/286 - (38%)
Similarity:154/286 - (53%) Gaps:20/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDKDAAKGFYAKYEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATR 75
            |.:| .|.||..  .|| ||||.......|.||.|||.||.|.|........|:.      |..|
plant    65 PYED-VKLFYTL--SKE-LGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKGDK------EDMR 119

  Fly    76 QEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEG 140
            :||.|::.:.|.|.|::.:..:|.:..|.||.|||..|||||.:.:....||:...::.|||...
plant   120 REIQIMQHLSGQPNIVEFKGAYEDEKAVNLVMELCAGGELFDRILAKGHYSERAAASVCRQIVNV 184

  Fly   141 VEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCN 202
            |...|...::||||||||.||   ||...:|.||||.:..::||....::.|:..|:|||.||..
plant   185 VNICHFMGVMHRDLKPENFLLSSKDEKALIKATDFGLSVFIEEGRVYKDIVGSAYYVAPEVLKRR 249

  Fly   203 MFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDL 267
                   |.:|:|||:.|:|::.||.|.||||...:..:...|:||:..|.|..|..||...|||
plant   250 -------YGKEIDIWSAGIILYILLSGVPPFWAETEKGIFDAILEGEIDFESQPWPSISNSAKDL 307

  Fly   268 IRKCLVVDPSQRITVKEVLRHPFFNQ 293
            :|:.|..||.:||:..|||:||:..:
plant   308 VRRMLTQDPKRRISAAEVLKHPWLRE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 108/274 (39%)
S_TKc 23..291 CDD:214567 106/270 (39%)
CPK33NP_001320603.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.