DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and AT1G49580

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_175381.1 Gene:AT1G49580 / 841382 AraportID:AT1G49580 Length:606 Species:Arabidopsis thaliana


Alignment Length:297 Identity:99/297 - (33%)
Similarity:156/297 - (52%) Gaps:22/297 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDEEDDLLPDK--DAAKGFYAKYEPKEILGRG-ISSTVRRCIEKE--TGKEFAAKIIDLGATTES 62
            ::||:::..||  ..:|.|:::.|..|.:||| ...|.....:|.  .|:..|.|||.....|.:
plant   128 REEEEEVGLDKRFGFSKEFHSRVELGEEIGRGHFGYTCSAKFKKGELKGQVVAVKIIPKSKMTTA 192

  Fly    63 GETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFD-YLTSVVTLS 126
                  ..:|..|:|:.||:.:.||..::...|.||.:|.|::..|||..|||.| .|......|
plant   193 ------IAIEDVRREVKILQALSGHKNLVQFYDAFEDNANVYIAMELCEGGELLDRILARGGKYS 251

  Fly   127 EKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILL---DENHNVKITDFGFAKQLQEGEKLTNLC 188
            |...:.::.||...|.:.|.:.:|||||||||.|.   :||..:|..|||.:..::..|:|.::.
plant   252 ENDAKPVIIQILNVVAFCHFQGVVHRDLKPENFLYTSKEENSQLKAIDFGLSDFVRPDERLNDIV 316

  Fly   189 GTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFT 253
            |:..|:|||.|       ...|:.|.|:|:.|||.:.||.|..|||.|.:..:.|.:::...||.
plant   317 GSAYYVAPEVL-------HRSYTTEADVWSIGVIAYILLCGSRPFWARTESGIFRAVLKADPSFD 374

  Fly   254 SPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPF 290
            .|.|..:|.|.||.:::.|..||.:|::..:.|.||:
plant   375 EPPWPFLSSDAKDFVKRLLFKDPRRRMSASQALMHPW 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 94/279 (34%)
S_TKc 23..291 CDD:214567 93/275 (34%)
AT1G49580NP_175381.1 S_TKc 151..412 CDD:214567 93/274 (34%)
STKc_CAMK 151..411 CDD:270687 92/272 (34%)
FRQ1 452..592 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.