DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PhKgamma and CDPK2

DIOPT Version :9

Sequence 1:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_174807.1 Gene:CDPK2 / 840471 AraportID:AT1G35670 Length:495 Species:Arabidopsis thaliana


Alignment Length:313 Identity:109/313 - (34%)
Similarity:159/313 - (50%) Gaps:44/313 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHML------EATRQEISILRQVMGH 87
            ||:|...|...|.||.|...:|.|.|            |...|      |...:||.|:..:..|
plant    32 LGQGQFGTTYLCTEKSTSANYACKSI------------PKRKLVCREDYEDVWREIQIMHHLSEH 84

  Fly    88 PYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHR 152
            |.::.::..:|...||.:|.|:|..|||||.:.|....||::...:::.|...||..|:..::||
plant    85 PNVVRIKGTYEDSVFVHIVMEVCEGGELFDRIVSKGHFSEREAVKLIKTILGVVEACHSLGVMHR 149

  Fly   153 DLKPENILLD---ENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETL-KCNMFEGSPGYSQE 213
            ||||||.|.|   ::..:|.||||.:...:.|:.|.::.|:|.|:|||.| ||        |..|
plant   150 DLKPENFLFDSPKDDAKLKATDFGLSVFYKPGQYLYDVVGSPYYVAPEVLKKC--------YGPE 206

  Fly   214 VDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADISEDPKDLIRKCLVVDPSQ 278
            :|:|:.|||::.||.|.||||...:..:.|.|::||..|.|..|..|||..||||.|.|...|.:
plant   207 IDVWSAGVILYILLSGVPPFWAETESGIFRQILQGKLDFKSDPWPTISEAAKDLIYKMLERSPKK 271

  Fly   279 RITVKEVLRHPFFNQMVLMGDRRHPAPPIAPAQTNSRHLLQPEASSYRFGQLN 331
            ||:..|.|.||:     ::.::..|..|:.||..:  .|.|       |.|:|
plant   272 RISAHEALCHPW-----IVDEQAAPDKPLDPAVLS--RLKQ-------FSQMN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 100/271 (37%)
S_TKc 23..291 CDD:214567 100/271 (37%)
CDPK2NP_174807.1 STKc_CAMK 25..283 CDD:270687 99/270 (37%)
Pkinase 26..284 CDD:278497 100/276 (36%)
PTZ00184 320..462 CDD:185504
EFh 332..391 CDD:238008
EFh 404..463 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.